Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ProTx-I

Protoxin I (ProTx-I; β-theraphotoxin-Tp1a) is a toxin that was originally isolated from the venom of Thrixopelma pruriens (Peruvian green velvet tarantula) . This toxin reversibly inhibits the tetrodotoxin (TTX) -resistant channel Nav1.8 (IC50 = 27 nM) and Nav1.2, Nav1.5 and Nav1.7 with IC50 values between 50 and 100 nM. Furthermore, ProTx-I shifts the voltage dependence activity of T-type Cav3.1 channels (IC50= 50 nM) without affecting the voltage dependence of inactivation. ProTx-I is a valuable tool to discriminate between Cav3.1 and Cav3.2

Product Specifications

Specifications

Blocker of voltage-gated sodium channels and T-type Cav

Target

Na channels

Sequence

ECRYWLGGCSAGQTCCKHLVCSRRHGWCVWDGTFS

Peptide Number

12PTX001

Disulfide Bonds

Cys2-Cys16; Cys9-Cys21; Cys15-Cys28

N Terminal Sequence

H

C Terminal Sequence

OH

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Rat Sterol O-acyltransferase 2 (Soat2), partial
MBS7057100 Inquire

Recombinant Rat Sterol O-acyltransferase 2 (Soat2), partial

Sign In for Pricing
View Details
Churc1 Mouse shRNA Lentiviral Particle (Locus ID 211151)
TL519910V 500 µL Each

Churc1 Mouse shRNA Lentiviral Particle (Locus ID 211151)

Sign In for Pricing
View Details
PRB4 Rabbit pAb (APR23294N)
APR23294N-01 50 µL

PRB4 Rabbit pAb (APR23294N)

Sign In for Pricing
View Details
PRB4 Rabbit pAb (APR23294N)
APR23294N-02 100 µL

PRB4 Rabbit pAb (APR23294N)

Sign In for Pricing
View Details
PRB4 Rabbit pAb (APR23294N)
APR23294N-03 200 µL

PRB4 Rabbit pAb (APR23294N)

Sign In for Pricing
View Details
SMC6 Antibody
MBS9404627-01 0.1 mL

SMC6 Antibody

Sign In for Pricing
View Details