Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ProTx-I

Protoxin I (ProTx-I; β-theraphotoxin-Tp1a) is a toxin that was originally isolated from the venom of Thrixopelma pruriens (Peruvian green velvet tarantula) . This toxin reversibly inhibits the tetrodotoxin (TTX) -resistant channel Nav1.8 (IC50 = 27 nM) and Nav1.2, Nav1.5 and Nav1.7 with IC50 values between 50 and 100 nM. Furthermore, ProTx-I shifts the voltage dependence activity of T-type Cav3.1 channels (IC50= 50 nM) without affecting the voltage dependence of inactivation. ProTx-I is a valuable tool to discriminate between Cav3.1 and Cav3.2

Product Specifications

Specifications

Blocker of voltage-gated sodium channels and T-type Cav

Target

Na channels

Sequence

ECRYWLGGCSAGQTCCKHLVCSRRHGWCVWDGTFS

Peptide Number

12PTX001

Disulfide Bonds

Cys2-Cys16; Cys9-Cys21; Cys15-Cys28

N Terminal Sequence

H

C Terminal Sequence

OH

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral mouse Cxcl9 shRNA (UAS) - Lentiviral mouse Cxcl9 shRNA (UAS, iRFP) (25)
GTR15234338 1 Vial

Lentiviral mouse Cxcl9 shRNA (UAS) - Lentiviral mouse Cxcl9 shRNA (UAS, iRFP) (25)

Sign In for Pricing
View Details
Phospho-MCM2 (S27) (18H13) Rabbit Monoclonal Antibody
E28M6839 100 µL

Phospho-MCM2 (S27) (18H13) Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
RGS9 Rabbit Polyclonal Antibody (APC)
orb2574559 100 µg

RGS9 Rabbit Polyclonal Antibody (APC)

Sign In for Pricing
View Details
ANR10 Rabbit Polyclonal Antibody
JOT-AP01827-01 20 µL

ANR10 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
ANR10 Rabbit Polyclonal Antibody
JOT-AP01827-02 50 μL

ANR10 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
ANR10 Rabbit Polyclonal Antibody
JOT-AP01827-03 100 µL

ANR10 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details