Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Phrixotoxin-2

Phrixotoxin-2 (PaTx2) has been isolated originally from the venom of the Chile fire tarantula Phrixotrichus auratus. Phrixotoxin-2 is a 31 amino acid peptide that contains three disulfide bridges. Phrixotoxin-2 specifically blocks recombinant Kv4.2 and Kv4.3 currents with IC50 values of 34 nM and 71 nM, respectively. It does so by altering the gating properties of the channels. The inhibition of Kv4.2 and Kv4.3 currents is fully reversible upon washout. Kv4.1 is only slightly sensitive to Phrixotoxin-2 (maximal block of 20 by 300 nM) . Kv1, Kv2 and Kv3 channel subfamilies are insensitive to this toxin.

Product Specifications

CAS Number

221889-63-0

Specifications

Blocker of Kv4.2 and Kv4.3 channels

Target

K channels

Sequence

YCQKWMWTCDEERKCCEGLVCRLWCKRIINM

Peptide Number

PHX002

Disulfide Bonds

Cys2-Cys16; Cys9-Cys21; Cys15-Cys25

N Terminal Sequence

H

C Terminal Sequence

NH2

More Discoveries

Explore Other Products

Browse additional items from our catalog

ZNF770 Rabbit Polyclonal Antibody (BF750)
orb2499436 100 µL

ZNF770 Rabbit Polyclonal Antibody (BF750)

Sign In for Pricing
View Details
2- ((4-Methylphenyl) sulfonyl) -5-phenylpenta-2,4-dienenitrile
FM169917 5000 mg

2- ((4-Methylphenyl) sulfonyl) -5-phenylpenta-2,4-dienenitrile

Sign In for Pricing
View Details
NIPSNAP2 Mouse Monoclonal Antibody [Clone ID: LBI1B8]
AMM13291V 100 µL

NIPSNAP2 Mouse Monoclonal Antibody [Clone ID: LBI1B8]

Sign In for Pricing
View Details
4- (Chloromethyl) -1,3-dioxane
BAA12162-01 100 mg

4- (Chloromethyl) -1,3-dioxane

Sign In for Pricing
View Details
4- (Chloromethyl) -1,3-dioxane
BAA12162-02 1 g

4- (Chloromethyl) -1,3-dioxane

Sign In for Pricing
View Details
CCL7 Peptide
orb2021419 100 µg

CCL7 Peptide

Sign In for Pricing
View Details