Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Phrixotoxin-2

Phrixotoxin-2 (PaTx2) has been isolated originally from the venom of the Chile fire tarantula Phrixotrichus auratus. Phrixotoxin-2 is a 31 amino acid peptide that contains three disulfide bridges. Phrixotoxin-2 specifically blocks recombinant Kv4.2 and Kv4.3 currents with IC50 values of 34 nM and 71 nM, respectively. It does so by altering the gating properties of the channels. The inhibition of Kv4.2 and Kv4.3 currents is fully reversible upon washout. Kv4.1 is only slightly sensitive to Phrixotoxin-2 (maximal block of 20 by 300 nM) . Kv1, Kv2 and Kv3 channel subfamilies are insensitive to this toxin.

Product Specifications

CAS Number

221889-63-0

Specifications

Blocker of Kv4.2 and Kv4.3 channels

Target

K channels

Sequence

YCQKWMWTCDEERKCCEGLVCRLWCKRIINM

Peptide Number

PHX002

Disulfide Bonds

Cys2-Cys16; Cys9-Cys21; Cys15-Cys25

N Terminal Sequence

H

C Terminal Sequence

NH2

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human Bisphosphoglycerate mutase (BPGM)
orb1647464-01 20 µg

Recombinant Human Bisphosphoglycerate mutase (BPGM)

Sign In for Pricing
View Details
Recombinant Human Bisphosphoglycerate mutase (BPGM)
orb1647464-02 100 µg

Recombinant Human Bisphosphoglycerate mutase (BPGM)

Sign In for Pricing
View Details
Recombinant Human Bisphosphoglycerate mutase (BPGM)
orb1647464-03 1 mg

Recombinant Human Bisphosphoglycerate mutase (BPGM)

Sign In for Pricing
View Details
TM6SF1, NT (TM6SF1, Transmembrane 6 superfamily member 1) (AP)
MBS6356075-01 0.2 mL

TM6SF1, NT (TM6SF1, Transmembrane 6 superfamily member 1) (AP)

Sign In for Pricing
View Details
TM6SF1, NT (TM6SF1, Transmembrane 6 superfamily member 1) (AP)
MBS6356075-02 5x 0.2 mL

TM6SF1, NT (TM6SF1, Transmembrane 6 superfamily member 1) (AP)

Sign In for Pricing
View Details
CD16/CD32 Rat Monoclonal Antibody (APC)
orb2972411-01 50 Tests

CD16/CD32 Rat Monoclonal Antibody (APC)

Sign In for Pricing
View Details