Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

OD1

OD1 is a scorpion peptide that has been isolated initially from the venom of the scorpion Odonthobuthus doriae. OD1 potently inhibits fast inactivation of mammalian channels Nav1.7 (EC50 4.5 nM), Nav1.4 (EC50 10 ± 2 nM) and Nav1.6 (EC50 47 ± 10 nM) . OD1 also blocks fast inactivation of the para/tipE insect channel (EC50 80 nM) . OD1 weakly affects mammalian Nav1.3 and Nav1.5 (EC50 > 1 μM) and does not affect Nav1.2 and Nav1.8. OD1 induces spontaneous pain when injected in animal in association with our without Veratridine and can be used to test the analgesic effects of Nav1.7 blockers in-vivo.

Product Specifications

Specifications

Nav1.7 channel activator

Target

Na channels

Sequence

GVRDAYIADDKNCVYTCASNGYCNTECTKNGAESGYCQWIGRYGNACWCIKLPDEVPIRIPGKCR

Peptide Number

ODX001

Disulfide Bonds

Cys13-Cys64; Cys17-Cys37; Cys23-Cys47; Cys27-Cys49

N Terminal Sequence

H

C Terminal Sequence

NH2

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CADM4 Antibody
E11-12111C 100 µg

CADM4 Antibody

Sign In for Pricing
View Details
Hsa-miR-543 miRNA Antagomir
CIJ0673-01 10 nmol

Hsa-miR-543 miRNA Antagomir

Sign In for Pricing
View Details
Hsa-miR-543 miRNA Antagomir
CIJ0673-02 20 nmol

Hsa-miR-543 miRNA Antagomir

Sign In for Pricing
View Details
PCDH11X Polyclonal Antibody, PerCP-Cy5.5 Conjugated
bs-11107R-PerCP-Cy5.5 100 µL

PCDH11X Polyclonal Antibody, PerCP-Cy5.5 Conjugated

Sign In for Pricing
View Details
FAM107A Protein Vector (Rat) (pPB-N-His)
PV267083 500 ng

FAM107A Protein Vector (Rat) (pPB-N-His)

Sign In for Pricing
View Details
NRP2 Recombinant Protein
OPCD05807-10UG 10 µg

NRP2 Recombinant Protein

Sign In for Pricing
View Details