Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

OD1

OD1 is a scorpion peptide that has been isolated initially from the venom of the scorpion Odonthobuthus doriae. OD1 potently inhibits fast inactivation of mammalian channels Nav1.7 (EC50 4.5 nM), Nav1.4 (EC50 10 ± 2 nM) and Nav1.6 (EC50 47 ± 10 nM) . OD1 also blocks fast inactivation of the para/tipE insect channel (EC50 80 nM) . OD1 weakly affects mammalian Nav1.3 and Nav1.5 (EC50 > 1 μM) and does not affect Nav1.2 and Nav1.8. OD1 induces spontaneous pain when injected in animal in association with our without Veratridine and can be used to test the analgesic effects of Nav1.7 blockers in-vivo.

Product Specifications

Specifications

Nav1.7 channel activator

Target

Na channels

Sequence

GVRDAYIADDKNCVYTCASNGYCNTECTKNGAESGYCQWIGRYGNACWCIKLPDEVPIRIPGKCR

Peptide Number

ODX001

Disulfide Bonds

Cys13-Cys64; Cys17-Cys37; Cys23-Cys47; Cys27-Cys49

N Terminal Sequence

H

C Terminal Sequence

NH2

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Dab1 Polyclonal Antibody, APC Conjugated
bs-22260R-APC 100 µL

Dab1 Polyclonal Antibody, APC Conjugated

Sign In for Pricing
View Details
Human Gliadorphin (Gliadorphin) ELISA Kit
YP-W13204-01 48 Tests

Human Gliadorphin (Gliadorphin) ELISA Kit

Sign In for Pricing
View Details
Human Gliadorphin (Gliadorphin) ELISA Kit
YP-W13204-02 96 Tests

Human Gliadorphin (Gliadorphin) ELISA Kit

Sign In for Pricing
View Details
mmu-miR-7653-3p miRNA Mimic
MBS8302396-01 5 nmol

mmu-miR-7653-3p miRNA Mimic

Sign In for Pricing
View Details
mmu-miR-7653-3p miRNA Mimic
MBS8302396-02 10 nmol

mmu-miR-7653-3p miRNA Mimic

Sign In for Pricing
View Details
mmu-miR-7653-3p miRNA Mimic
MBS8302396-03 5x 10 nmol

mmu-miR-7653-3p miRNA Mimic

Sign In for Pricing
View Details