Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Maurotoxin

Maurotoxin is a component of the venom of Scorpio maurus palmatus. Maurotoxin is a member of the α-KTx6.2 scorpion toxin family. It blocks voltage-gated potassium channels (KV1.1/KCNA1, KV1.2/KCNA2, and KV1.3/KCNA3) and inhibits apamin-sensitive small conductance calcium-activated channels (SK channels), particularly KCa3.1 (IKca1, SK4) . The blockage of Kv1.2 occurs with high affinity.

Product Specifications

Specifications

Kv and SK channels blocker

Target

K channels

Sequence

VSCTGSKDCYAPCRKQTGCPNAKCINKSCKCYGC

Peptide Number

08MAR001

Disulfide Bonds

Cys3-Cys24; Cys9-Cys29; Cys13-Cys19; Cys31-Cys34

N Terminal Sequence

H

C Terminal Sequence

NH2

More Discoveries

Explore Other Products

Browse additional items from our catalog

CP045, ID (C16orf45, Uncharacterized protein C16orf45) (MaxLight 550) discontinued
034152-ML550 100 µL

CP045, ID (C16orf45, Uncharacterized protein C16orf45) (MaxLight 550) discontinued

Sign In for Pricing
View Details
Anti-CAPON/NOS1AP Antibody
B2022448 100 µg/Vial

Anti-CAPON/NOS1AP Antibody

Sign In for Pricing
View Details
Rab 26 discontinued
346675-01 100 µL

Rab 26 discontinued

Sign In for Pricing
View Details
Rab 26 discontinued
346675-02 200 µL

Rab 26 discontinued

Sign In for Pricing
View Details
CYP1B1 (Cytochrome P450 1B1, CYPIB1, Cytochrome P450CMEF, Cytochrome P450EF, Cyp1-b1) (MaxLight 405) discontinued
125564-ML405 100 µL

CYP1B1 (Cytochrome P450 1B1, CYPIB1, Cytochrome P450CMEF, Cytochrome P450EF, Cyp1-b1) (MaxLight 405) discontinued

Sign In for Pricing
View Details
Tanc2 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 3)
K4910608 1.0 µg DNA

Tanc2 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 3)

Sign In for Pricing
View Details