Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Mambalgin-1

Mambalgin-1 was initially isolated by Sylvie Diochot and collaborators from the venom of the black mamba (Dendroaspis polylepis polylepis) . Mambalgin-1 is a potent and selective blocker of acid-sensing ion channels (ASIC) . ASIC channels have been demonstrated to be implied in pain pathways and appear to be promising therapeutic targets. Mambalgin-1 rapidly and reversibly inhibits recombinant homomeric ASIC1a (IC50=55 nM) and heteromeric ASIC1a+ASIC2a (IC50=246 nM) or ASIC1a+ASIC2b channels (IC50=61 nM) but also human channels hASIC1b (IC50=192 nM) and hASIC1a+hASIC1b (IC50=72nM) .Mambalgin-1 belongs to the family of three-finger toxins and has no sequence/structural homology with either PcTx1 or APETx2. Mambalgin-1 differs from mambalgin-2 by one amino acid. Both have demonstrated a similar activity. Mambalgin-1 has no effect on ASIC2a, ASIC3, ASIC1a+ASIC3 and ASIC1b+ASIC3 channels, as well as on TRPV1, P2X2,5-HT3A, Nav1.8, Cav3.2 and Kv1.2 channels.

Product Specifications

Specifications

ASIC1a & 1b channel blocker

Target

ASIC channels

Sequence

LKCYQHGKVVTCHRDMKFCYHNTGMPFRNLKLILQGCSSSCSETENNKCCSTDRCNK

Peptide Number

MAM001

Disulfide Bonds

Cys3-Cys19; Cys12-Cys37; Cys41-Cys49; Cys50-Cys55

N Terminal Sequence

H

C Terminal Sequence

OH

More Discoveries

Explore Other Products

Browse additional items from our catalog

GLP-1 (7-36) Polyclonal Antibody, AbBy Fluor™ 647 Conjugated
bs-0038R-BF647-01 20 µL

GLP-1 (7-36) Polyclonal Antibody, AbBy Fluor™ 647 Conjugated

Sign In for Pricing
View Details
GLP-1 (7-36) Polyclonal Antibody, AbBy Fluor™ 647 Conjugated
bs-0038R-BF647-02 100 µL

GLP-1 (7-36) Polyclonal Antibody, AbBy Fluor™ 647 Conjugated

Sign In for Pricing
View Details
Fmoc-Cys (t-Bu) TentaGel® S AC Resin
SA1108.1G 1 g

Fmoc-Cys (t-Bu) TentaGel® S AC Resin

Sign In for Pricing
View Details
Genorise® Human IgM-FITC Polyclonal Antibody
GR126156 100 µg

Genorise® Human IgM-FITC Polyclonal Antibody

Sign In for Pricing
View Details
DDR1 (C-6) Alexa Fluor® 488
sc-374618 AF488 200 µg/mL

DDR1 (C-6) Alexa Fluor® 488

Sign In for Pricing
View Details
HSP90 alpha / beta Antibody (PE)
abx448267 100 µg

HSP90 alpha / beta Antibody (PE)

Sign In for Pricing
View Details