Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Mambalgin-1

Mambalgin-1 was initially isolated by Sylvie Diochot and collaborators from the venom of the black mamba (Dendroaspis polylepis polylepis) . Mambalgin-1 is a potent and selective blocker of acid-sensing ion channels (ASIC) . ASIC channels have been demonstrated to be implied in pain pathways and appear to be promising therapeutic targets. Mambalgin-1 rapidly and reversibly inhibits recombinant homomeric ASIC1a (IC50=55 nM) and heteromeric ASIC1a+ASIC2a (IC50=246 nM) or ASIC1a+ASIC2b channels (IC50=61 nM) but also human channels hASIC1b (IC50=192 nM) and hASIC1a+hASIC1b (IC50=72nM) .Mambalgin-1 belongs to the family of three-finger toxins and has no sequence/structural homology with either PcTx1 or APETx2. Mambalgin-1 differs from mambalgin-2 by one amino acid. Both have demonstrated a similar activity. Mambalgin-1 has no effect on ASIC2a, ASIC3, ASIC1a+ASIC3 and ASIC1b+ASIC3 channels, as well as on TRPV1, P2X2,5-HT3A, Nav1.8, Cav3.2 and Kv1.2 channels.

Product Specifications

Specifications

ASIC1a & 1b channel blocker

Target

ASIC channels

Sequence

LKCYQHGKVVTCHRDMKFCYHNTGMPFRNLKLILQGCSSSCSETENNKCCSTDRCNK

Peptide Number

MAM001

Disulfide Bonds

Cys3-Cys19; Cys12-Cys37; Cys41-Cys49; Cys50-Cys55

N Terminal Sequence

H

C Terminal Sequence

OH

More Discoveries

Explore Other Products

Browse additional items from our catalog

Major Vault Protein (MVP) (1032), CF405S conjugate, 0.1mg/mL
BNC040225-500 1x 500 µL

Major Vault Protein (MVP) (1032), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Human Neuroligin-1 (NLGN1) ELISA Kit
MBS167249-01 48 Well

Human Neuroligin-1 (NLGN1) ELISA Kit

Sign In for Pricing
View Details
Human Neuroligin-1 (NLGN1) ELISA Kit
MBS167249-02 96 Well

Human Neuroligin-1 (NLGN1) ELISA Kit

Sign In for Pricing
View Details
Human Neuroligin-1 (NLGN1) ELISA Kit
MBS167249-03 5x 96 Well

Human Neuroligin-1 (NLGN1) ELISA Kit

Sign In for Pricing
View Details
Human Neuroligin-1 (NLGN1) ELISA Kit
MBS167249-04 10x 96 Well

Human Neuroligin-1 (NLGN1) ELISA Kit

Sign In for Pricing
View Details
N-[2- (2,3-Dimethoxyphenyl) ethyl]-2-chlorobenzamide
FD66108-01 100 mg

N-[2- (2,3-Dimethoxyphenyl) ethyl]-2-chlorobenzamide

Sign In for Pricing
View Details