Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Huwentoxin-XVI

Huwentoxin-XVI is a 39 amino acids peptide that was discovered from the venom of the Chinese tarantula Ornithoctonus huwena. Huwentoxin-XVI was shown to be a potent blocker of HVA N-type calcium channels with an IC50 value of 60 nM in rat DRG. The blocking effect appears to be similar to that of ω-conotoxin-GVIA and ω-conotoxin-MVIIA. Neverthelss, Huwentoxin-XVI differs from GVIA and MVIIA thanks to its greater reversibility and its higher selectivity for N-type over P/Q type than MVIIA.

Product Specifications

Specifications

Selective blocker of N-type Ca2+ channels

Target

Ca channels

Sequence

CIGEGVPCDENDPRCCSGLVCLKPTLHGIWYKSYYCYKK

Peptide Number

HWT016

Disulfide Bonds

Cys1-Cys16; Cys8-Cys21; Cys15-Cys36

N Terminal Sequence

H

C Terminal Sequence

OH

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CASP8AP2 Protein Vector (Mouse) (pPB-C-His)
PV161718 500 ng

CASP8AP2 Protein Vector (Mouse) (pPB-C-His)

Sign In for Pricing
View Details
CHRNA1 Antibody
MBS8516698-01 0.1 mg

CHRNA1 Antibody

Sign In for Pricing
View Details
CHRNA1 Antibody
MBS8516698-02 0.1 mL (AF635)

CHRNA1 Antibody

Sign In for Pricing
View Details
CHRNA1 Antibody
MBS8516698-03 0.1 mL (AF610)

CHRNA1 Antibody

Sign In for Pricing
View Details
CHRNA1 Antibody
MBS8516698-04 0.1 mL (AF405S)

CHRNA1 Antibody

Sign In for Pricing
View Details
CHRNA1 Antibody
MBS8516698-05 0.1 mL (AF405L)

CHRNA1 Antibody

Sign In for Pricing
View Details