Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Huwentoxin-XVI

Huwentoxin-XVI is a 39 amino acids peptide that was discovered from the venom of the Chinese tarantula Ornithoctonus huwena. Huwentoxin-XVI was shown to be a potent blocker of HVA N-type calcium channels with an IC50 value of 60 nM in rat DRG. The blocking effect appears to be similar to that of ω-conotoxin-GVIA and ω-conotoxin-MVIIA. Neverthelss, Huwentoxin-XVI differs from GVIA and MVIIA thanks to its greater reversibility and its higher selectivity for N-type over P/Q type than MVIIA.

Product Specifications

Specifications

Selective blocker of N-type Ca2+ channels

Target

Ca channels

Sequence

CIGEGVPCDENDPRCCSGLVCLKPTLHGIWYKSYYCYKK

Peptide Number

HWT016

Disulfide Bonds

Cys1-Cys16; Cys8-Cys21; Cys15-Cys36

N Terminal Sequence

H

C Terminal Sequence

OH

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Dynamin 1 (DNM1) (NM_001005336) Human Recombinant Protein
TP306284M 100 µg

Dynamin 1 (DNM1) (NM_001005336) Human Recombinant Protein

Sign In for Pricing
View Details
Glutathione S Transferases (GSTs) Rabbit ELISA Kit
D8786 96 Tests

Glutathione S Transferases (GSTs) Rabbit ELISA Kit

Sign In for Pricing
View Details
Biotin-YVAD-FMK
TP3559-01 10 mg

Biotin-YVAD-FMK

Sign In for Pricing
View Details
Biotin-YVAD-FMK
TP3559-02 50 mg

Biotin-YVAD-FMK

Sign In for Pricing
View Details
Human Chemokine C-C-Motif Ligand 14 (CCL14) ELISA Kit
MBS2702947-01 24 Strip Well

Human Chemokine C-C-Motif Ligand 14 (CCL14) ELISA Kit

Sign In for Pricing
View Details
Human Chemokine C-C-Motif Ligand 14 (CCL14) ELISA Kit
MBS2702947-02 48 Well

Human Chemokine C-C-Motif Ligand 14 (CCL14) ELISA Kit

Sign In for Pricing
View Details