Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Huwentoxin-XVI

Huwentoxin-XVI is a 39 amino acids peptide that was discovered from the venom of the Chinese tarantula Ornithoctonus huwena. Huwentoxin-XVI was shown to be a potent blocker of HVA N-type calcium channels with an IC50 value of 60 nM in rat DRG. The blocking effect appears to be similar to that of ω-conotoxin-GVIA and ω-conotoxin-MVIIA. Neverthelss, Huwentoxin-XVI differs from GVIA and MVIIA thanks to its greater reversibility and its higher selectivity for N-type over P/Q type than MVIIA.

Product Specifications

Specifications

Selective blocker of N-type Ca2+ channels

Target

Ca channels

Sequence

CIGEGVPCDENDPRCCSGLVCLKPTLHGIWYKSYYCYKK

Peptide Number

HWT016

Disulfide Bonds

Cys1-Cys16; Cys8-Cys21; Cys15-Cys36

N Terminal Sequence

H

C Terminal Sequence

OH

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TMC8 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 1)
K2383706 1.0 µg DNA

TMC8 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 1)

Sign In for Pricing
View Details
BTD Lentiviral Vector (Rat) (EF1a) (pLenti-GIII-EF1a)
LV683010 1.0 µg DNA

BTD Lentiviral Vector (Rat) (EF1a) (pLenti-GIII-EF1a)

Sign In for Pricing
View Details
PPP2CA Protein Vector (Rat) (pPM-C-His)
PV295725 500 ng

PPP2CA Protein Vector (Rat) (pPM-C-His)

Sign In for Pricing
View Details
CEP63 Mouse Monoclonal Antibody [Clone ID: LBI2H2]
AMM18903V 100 µL

CEP63 Mouse Monoclonal Antibody [Clone ID: LBI2H2]

Sign In for Pricing
View Details
Rabbit Polyclonal Isopeptidase T/USP5 Antibody
NBP2-97889-50ul 50 µL

Rabbit Polyclonal Isopeptidase T/USP5 Antibody

Sign In for Pricing
View Details
Mouse Monoclonal TREM1 Antibody (193015) [Janelia Fluor 549]
FAB1278I 0.1 mL

Mouse Monoclonal TREM1 Antibody (193015) [Janelia Fluor 549]

Sign In for Pricing
View Details