Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Hainantoxin-III

Hainantoxin-III (HNTX-III; hainantoxin-3) is a peptide that has been isolated from the venom of the Chinese bird spider Seleconosmia hainana. Hainantoxin-III specifically blocks mammalian neuronal tetrodotoxin-sensitive voltage-gated sodium channels (VGSCs) . Hainantoxin III was found inactive on tetrodotoxin-resistant VGSCs and voltage-gated Ca2+channels (both high and low voltage-activated) . Hainantoxin-III strongly depressed the amplitude of rat DRG tetrodotoxin-sensitive Na+ currents with an IC50 value of 1.1 nM. Like Hainantoxin-IV, Hainantoxin-III causes a hyperpolarizing shift of about 10 mV in the voltage midpoint of steady-state Na+ channel inactivation. Similar to Huwentoxin-IV, Hainantoxin-III and Hainantoxin-IV do not affect the activation and inactivation kinetics of Na+ currents. Hainantoxin-III inhibits Nav1.7 current amplitude without significantly altering the activation and inactivation kinetics. Hainantoxin-III increases the deactivation of the Nav1.7 current after extreme depolarizations. Hainantoxin-III seems to interact with site 4 and to trap the domain II voltage sensor in the closed state. The inhibition of Nav1.7 by hainantoxin-III is reversible upon washing, but no reversibility was observed for Hainantoxin-IV and Huwentoxin-IV. Hainantoxin-III was shown to block Nav1.1, Nav1.2, Nav1.3 and Nav1.7 expressed in HEK293 cells with IC50 values of 1.27 µM, 275 nM, 491 nM and 232 nM, respectively

Product Specifications

Specifications

Selective blocker of TTX-S VGSC

Target

Na channels

Sequence

GCKGFGDSCTPGKNECCPNYACSSKHKWCKVYL

Peptide Number

13HTX003

Disulfide Bonds

Cys2-Cys17; Cys9-Cys22; ; Cys16-Cys29

N Terminal Sequence

H

C Terminal Sequence

NH2

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Collagen 16 alpha 1 Rabbit Polyclonal Antibody
orb665868-01 30 µL

Collagen 16 alpha 1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Collagen 16 alpha 1 Rabbit Polyclonal Antibody
orb665868-02 50 μL

Collagen 16 alpha 1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Collagen 16 alpha 1 Rabbit Polyclonal Antibody
orb665868-03 100 µL

Collagen 16 alpha 1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Collagen 16 alpha 1 Rabbit Polyclonal Antibody
orb665868-04 200 µL

Collagen 16 alpha 1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
FGF5 Recombinant Protein
OPCD03207-200UG 200 µg

FGF5 Recombinant Protein

Sign In for Pricing
View Details
Rabbit anti-ILF2 Antibody
MBS4511420-01 0.05 mL

Rabbit anti-ILF2 Antibody

Sign In for Pricing
View Details