Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GsAF-2

GsAF-II (also termed Kappa-theraphotoxin-Gr2c, GsAF-2) was originally isolated from the venom of Grammostola rosea spider. GsAF-II peptide toxin has antinociceptive and antiarrhythmic effects in mammals. The peptide is reported to block the following voltage-gated sodium channels: Nav1.1, Nav1.2, Nav1.3, Nav1.4, Nav1.6 and Nav1.7 with IC50 values of, respectively, 5.7,12,24,4, 6.6 and 1.3 µM. This peptide also blocks hERG1 with an IC50 value of 4.7 µM.

Product Specifications

Specifications

Blocker of Nav1.1 / 1.2 / 1.3 / 1.4 / 1.6 / 1.7

Target

Na channels

Sequence

YCQKWMWTCDEERKCCEGLVCRLWCKKKIEW

Peptide Number

12GSF002

Disulfide Bonds

Cys2-Cys16; Cys9-Cys21; ; Cys15-Cys25

N Terminal Sequence

H

C Terminal Sequence

OH

More Discoveries

Explore Other Products

Browse additional items from our catalog

Pit-1 Lentiviral Activation Particles (m)
sc-422249-LAC 200 µL

Pit-1 Lentiviral Activation Particles (m)

Sign In for Pricing
View Details
CD21 discontinued
381114 200 µL

CD21 discontinued

Sign In for Pricing
View Details
Lentiviral mouse Cryz shRNA (UAS) - Lentiviral mouseCryz shRNA (UAS, GFP) (25)
GTR15158816 1 Vial

Lentiviral mouse Cryz shRNA (UAS) - Lentiviral mouseCryz shRNA (UAS, GFP) (25)

Sign In for Pricing
View Details
2- (Benzyloxy) -5-iodo-1,3-dimethylbenzene
OR1098679-01 250 mg

2- (Benzyloxy) -5-iodo-1,3-dimethylbenzene

Sign In for Pricing
View Details
2- (Benzyloxy) -5-iodo-1,3-dimethylbenzene
OR1098679-02 500 mg

2- (Benzyloxy) -5-iodo-1,3-dimethylbenzene

Sign In for Pricing
View Details
2- (Benzyloxy) -5-iodo-1,3-dimethylbenzene
OR1098679-03 1 g

2- (Benzyloxy) -5-iodo-1,3-dimethylbenzene

Sign In for Pricing
View Details