Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Crotamine

Crotamine is a basic peptide present in the venom of the South American rattlesnake Crotalus durissus terrificus. Multiple biological functions have been attributed to Crotamine. It is a natural cell-penetrating peptide with selective biological action towards actively proliferating cell types. Moreover, it has been reported that crotamine is a blocker of Kv1.3 (IC50 around 300 nM) as well as Kv1.1 and Kv1.2. It has analgesic properties and myonecrotic effects. In addition, crotamine belongs to the beta-defensin peptides and as such demonstrates antibacterial properties by interacting with lipid membranes.

Product Specifications

Specifications

Blocker of Kv1.3, Kv1.1 and Kv1.2 channels / Cell Penetrating Peptide

Target

Others

Sequence

YKQCHKKGGHCFPKEKICLPPSSDFGKMDCRWRWKCCKKGSG

Peptide Number

CRO001

Disulfide Bonds

Cys4-Cys36; Cys11-Cys30; Cys18-Cys37

N Terminal Sequence

H

C Terminal Sequence

OH

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

C1QTNF8 Antibody
orb1556334-01 50 μL

C1QTNF8 Antibody

Sign In for Pricing
View Details
C1QTNF8 Antibody
orb1556334-02 100 µL

C1QTNF8 Antibody

Sign In for Pricing
View Details
C1QTNF8 Antibody
orb1556334-03 200 µL

C1QTNF8 Antibody

Sign In for Pricing
View Details
DEGS2 siRNA (Rat)
MBS8205278-01 15 nmol

DEGS2 siRNA (Rat)

Sign In for Pricing
View Details
DEGS2 siRNA (Rat)
MBS8205278-02 30 nmol

DEGS2 siRNA (Rat)

Sign In for Pricing
View Details
DEGS2 siRNA (Rat)
MBS8205278-03 5x 30 nmol

DEGS2 siRNA (Rat)

Sign In for Pricing
View Details