Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Crotamine

Crotamine is a basic peptide present in the venom of the South American rattlesnake Crotalus durissus terrificus. Multiple biological functions have been attributed to Crotamine. It is a natural cell-penetrating peptide with selective biological action towards actively proliferating cell types. Moreover, it has been reported that crotamine is a blocker of Kv1.3 (IC50 around 300 nM) as well as Kv1.1 and Kv1.2. It has analgesic properties and myonecrotic effects. In addition, crotamine belongs to the beta-defensin peptides and as such demonstrates antibacterial properties by interacting with lipid membranes.

Product Specifications

Specifications

Blocker of Kv1.3, Kv1.1 and Kv1.2 channels / Cell Penetrating Peptide

Target

Others

Sequence

YKQCHKKGGHCFPKEKICLPPSSDFGKMDCRWRWKCCKKGSG

Peptide Number

CRO001

Disulfide Bonds

Cys4-Cys36; Cys11-Cys30; Cys18-Cys37

N Terminal Sequence

H

C Terminal Sequence

OH

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

WWTR1, CT (WWTR1, TAZ, WW domain-containing transcription regulator protein 1, Transcriptional coactivator with PDZ-binding motif) (Biotin)
MBS6363865-01 0.2 mL

WWTR1, CT (WWTR1, TAZ, WW domain-containing transcription regulator protein 1, Transcriptional coactivator with PDZ-binding motif) (Biotin)

Sign In for Pricing
View Details
WWTR1, CT (WWTR1, TAZ, WW domain-containing transcription regulator protein 1, Transcriptional coactivator with PDZ-binding motif) (Biotin)
MBS6363865-02 5x 0.2 mL

WWTR1, CT (WWTR1, TAZ, WW domain-containing transcription regulator protein 1, Transcriptional coactivator with PDZ-binding motif) (Biotin)

Sign In for Pricing
View Details
Rabbit Polyclonal FRG1 Antibody [mFluor Violet 450 SE]
NBP2-99204MFV450 0.1 mL

Rabbit Polyclonal FRG1 Antibody [mFluor Violet 450 SE]

Sign In for Pricing
View Details
Haspin (GSG2) (NM_031965) Human Over-expression Lysate
LY410416 100 µg

Haspin (GSG2) (NM_031965) Human Over-expression Lysate

Sign In for Pricing
View Details
uPA (PLAU) (NM_002658) Human Tagged ORF Clone Lentiviral Particle
RC202083L4V 200 µL

uPA (PLAU) (NM_002658) Human Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
MicroLoop E Assembly; box of 20 assemblies
B-M8-70V-B3S 20 Mounts/Base Assemblies

MicroLoop E Assembly; box of 20 assemblies

Sign In for Pricing
View Details