Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Chlorotoxin

Chlorotoxin (Cltx) is a neurotoxin that was originally isolated from the venom of Leiurus quinquestriatus. Chlorotoxin is a specific ligand of glioma cells. Chlorotoxin binds to Cl– channels (small conductance epithelial chloride channels) in the brain and spinal cord and inhibits Cl– influx. Chlorotoxin most probably acts as a specific blocker, although residues both inside and outside of the pore region of the Cl– channels participate in chlorotoxin binding. It was demonstrated that chlorotoxin inhibits specifically the activity of matrix metalloproteinase-2 (MMP-2) without affecting MMP-1, MMP-3 and MMP-9. MMP-2 are upregulated in glioma cells and related cells making chlorotoxin a promising antitumoral drug and diagnosis tool.

Product Specifications

CAS Number

163515-35-3

Specifications

Selective blocker of small conductance chloride channels

Target

Cl channels

Sequence

MCMPCFTTDHQMARKCDDCCGGKGRGKCYGPQCLCR

Peptide Number

08CHL001

Disulfide Bonds

Cys2-Cys19; Cys5-Cys28; Cys16-Cys33; Cys20-Cys35

N Terminal Sequence

H

C Terminal Sequence

NH2

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-Zebrafish snai1b Antibody, Cy3 Conjugate
DZ41229-Cy3 200 µL/Vial

Anti-Zebrafish snai1b Antibody, Cy3 Conjugate

Sign In for Pricing
View Details
ZBTB32 (Zinc Finger and BTB Domain Containing 32, FAXF, FAZF, Rog, TZFP, ZNF538)
253548 50 µL

ZBTB32 (Zinc Finger and BTB Domain Containing 32, FAXF, FAZF, Rog, TZFP, ZNF538)

Sign In for Pricing
View Details
Rat Fibronectin, FN ELISA Kit
MBS703777-01 24 Well (LIMIT 1)

Rat Fibronectin, FN ELISA Kit

Sign In for Pricing
View Details
Rat Fibronectin, FN ELISA Kit
MBS703777-02 48 Well

Rat Fibronectin, FN ELISA Kit

Sign In for Pricing
View Details
Rat Fibronectin, FN ELISA Kit
MBS703777-03 96 Well

Rat Fibronectin, FN ELISA Kit

Sign In for Pricing
View Details
Rat Fibronectin, FN ELISA Kit
MBS703777-04 5x 96 Well

Rat Fibronectin, FN ELISA Kit

Sign In for Pricing
View Details