Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Charybdotoxin

Charybdotoxin (ChTx) is a 37 amino acid peptide isolated from the venom of the scorpion Leiurus quinquestriatus hebraeus that blocks voltage-gated and large conductance Ca2+ activated K+ channels KCa1.1 in nanomolar concentrations (IC50~ 3 nM) . This blockade causes hyperexcitability of the nervous system. The toxin reversibly blocks channel activity by interacting at the external pore of the channel protein with an apparent Kd of 2.1 nM. ChTX also blocks KCa3.1 (IC50 5 nM), Kv1.2 (IC50 14 nM), Kv1.3 (IC50 2.6 nM) and Kv1.6 (IC50 2 nM) channels.

Product Specifications

CAS Number

95751-30-7

Specifications

KCa2+ channel blocker

Target

K channels

Sequence

FTNVSCTTSKECWSVCQRLHNTSRGKCMNKKCRCYS

Peptide Number

11CHA001

Disulfide Bonds

Cys7-Cys28; Cys13-Cys33; ; Cys17-Cys35

N Terminal Sequence

PQ

C Terminal Sequence

OH

More Discoveries

Explore Other Products

Browse additional items from our catalog

1700018C11Rik (Tex48) (NM_029324) Mouse Tagged Lenti ORF Clone
MR200419L3 10 µg

1700018C11Rik (Tex48) (NM_029324) Mouse Tagged Lenti ORF Clone

Sign In for Pricing
View Details
Recombinant Mycobacterium bovis Phosphoribosylformylglycinamidine synthase 2 (purL), partial
MBS1039449 Inquire

Recombinant Mycobacterium bovis Phosphoribosylformylglycinamidine synthase 2 (purL), partial

Sign In for Pricing
View Details
Human alpha-1A Adrenergic R/ADRA1A Alexa Fluor 405 MAb
FAB10298V-100UG 100 µg

Human alpha-1A Adrenergic R/ADRA1A Alexa Fluor 405 MAb

Sign In for Pricing
View Details
AKT1 (Ab-326) Antibody
A73288-100UL 100 µL

AKT1 (Ab-326) Antibody

Sign In for Pricing
View Details
MT1 ELISA Kit (Rat) (OKAN05195)
OKAN05195 96 Well

MT1 ELISA Kit (Rat) (OKAN05195)

Sign In for Pricing
View Details
Gm13285 sgRNA CRISPR Lentivector (Mouse) (Target 1)
K3809102 1.0 µg DNA

Gm13285 sgRNA CRISPR Lentivector (Mouse) (Target 1)

Sign In for Pricing
View Details