Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Charybdotoxin

Charybdotoxin (ChTx) is a 37 amino acid peptide isolated from the venom of the scorpion Leiurus quinquestriatus hebraeus that blocks voltage-gated and large conductance Ca2+ activated K+ channels KCa1.1 in nanomolar concentrations (IC50~ 3 nM) . This blockade causes hyperexcitability of the nervous system. The toxin reversibly blocks channel activity by interacting at the external pore of the channel protein with an apparent Kd of 2.1 nM. ChTX also blocks KCa3.1 (IC50 5 nM), Kv1.2 (IC50 14 nM), Kv1.3 (IC50 2.6 nM) and Kv1.6 (IC50 2 nM) channels.

Product Specifications

CAS Number

95751-30-7

Specifications

KCa2+ channel blocker

Target

K channels

Sequence

FTNVSCTTSKECWSVCQRLHNTSRGKCMNKKCRCYS

Peptide Number

11CHA001

Disulfide Bonds

Cys7-Cys28; Cys13-Cys33; ; Cys17-Cys35

N Terminal Sequence

PQ

C Terminal Sequence

OH

More Discoveries

Explore Other Products

Browse additional items from our catalog

MDMA-HRP Conjugate
OORB00210-500UL 0.5 mL

MDMA-HRP Conjugate

Sign In for Pricing
View Details
MRX12 3'UTR Lenti-reporter-Luc Vector
30639081 1.0 µg

MRX12 3'UTR Lenti-reporter-Luc Vector

Sign In for Pricing
View Details
CCL28 (NM_001301874) Human Tagged ORF Clone
RG235854 10 µg

CCL28 (NM_001301874) Human Tagged ORF Clone

Sign In for Pricing
View Details
MKRN2 Protein Vector (Rat) (pPM-C-HA)
30172026 500 ng

MKRN2 Protein Vector (Rat) (pPM-C-HA)

Sign In for Pricing
View Details
Human IQSEC2 shRNA Plasmid
abx957995-01 150 µg

Human IQSEC2 shRNA Plasmid

Sign In for Pricing
View Details
Human IQSEC2 shRNA Plasmid
abx957995-02 300 µg

Human IQSEC2 shRNA Plasmid

Sign In for Pricing
View Details