Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Agitoxin-2

Agitoxin-2 is a potent and selective blocker of the Shaker type voltage-gated Kv1.3 and Kv1.1 channels. Agitoxin-2 inhibits Kv1.3 with an IC50 value of around 200 pM and Kv1.1 with an IC50 value of around 140 pM. This peptide toxin was originally isolated from the venom of the Israeli scorpion L. quinquestriatus hebraeus.

Product Specifications

CAS Number

168147-41-9

Specifications

Blocker of Kv1.1 and Kv1.3 channels

Target

K channels

Sequence

GVPINVSCTGSPQCIKPCKDAGMRFGKCMNRKCHCTPK

Peptide Number

13AGI002

Disulfide Bonds

Cys8-Cys28; Cys14-Cys33; Cys18-Cys35

N Terminal Sequence

H

C Terminal Sequence

OH

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human CD88/C5AR1 Protein, N-His-SUMO
AP95648 50 µg

Recombinant Human CD88/C5AR1 Protein, N-His-SUMO

Sign In for Pricing
View Details
ADORA1 Polyclonal Antibody, AbBy Fluor™ 750 Conjugated
bs-6649R-BF750-01 20 µL

ADORA1 Polyclonal Antibody, AbBy Fluor™ 750 Conjugated

Sign In for Pricing
View Details
ADORA1 Polyclonal Antibody, AbBy Fluor™ 750 Conjugated
bs-6649R-BF750-02 100 µL

ADORA1 Polyclonal Antibody, AbBy Fluor™ 750 Conjugated

Sign In for Pricing
View Details
Exgene Cell SV (Bacterial DNA isolation, Mini)
106-152 250 Samples

Exgene Cell SV (Bacterial DNA isolation, Mini)

Sign In for Pricing
View Details
GAGE4 Protein Vector (Human) (pPB-C-His)
PV079921 500 ng

GAGE4 Protein Vector (Human) (pPB-C-His)

Sign In for Pricing
View Details
PRR20A siRNA (Human)
orb1853568-01 15 nmol

PRR20A siRNA (Human)

Sign In for Pricing
View Details