Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Agitoxin-2

Agitoxin-2 is a potent and selective blocker of the Shaker type voltage-gated Kv1.3 and Kv1.1 channels. Agitoxin-2 inhibits Kv1.3 with an IC50 value of around 200 pM and Kv1.1 with an IC50 value of around 140 pM. This peptide toxin was originally isolated from the venom of the Israeli scorpion L. quinquestriatus hebraeus.

Product Specifications

CAS Number

168147-41-9

Specifications

Blocker of Kv1.1 and Kv1.3 channels

Target

K channels

Sequence

GVPINVSCTGSPQCIKPCKDAGMRFGKCMNRKCHCTPK

Peptide Number

13AGI002

Disulfide Bonds

Cys8-Cys28; Cys14-Cys33; Cys18-Cys35

N Terminal Sequence

H

C Terminal Sequence

OH

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

HRP Linked Polyclonal Antibody to Interleukin 1 Beta (IL1b)
MBS2130080-01 0.1 mL

HRP Linked Polyclonal Antibody to Interleukin 1 Beta (IL1b)

Sign In for Pricing
View Details
HRP Linked Polyclonal Antibody to Interleukin 1 Beta (IL1b)
MBS2130080-02 0.2 mL

HRP Linked Polyclonal Antibody to Interleukin 1 Beta (IL1b)

Sign In for Pricing
View Details
HRP Linked Polyclonal Antibody to Interleukin 1 Beta (IL1b)
MBS2130080-03 0.5 mL

HRP Linked Polyclonal Antibody to Interleukin 1 Beta (IL1b)

Sign In for Pricing
View Details
HRP Linked Polyclonal Antibody to Interleukin 1 Beta (IL1b)
MBS2130080-04 1 mL

HRP Linked Polyclonal Antibody to Interleukin 1 Beta (IL1b)

Sign In for Pricing
View Details
HRP Linked Polyclonal Antibody to Interleukin 1 Beta (IL1b)
MBS2130080-05 5 mL

HRP Linked Polyclonal Antibody to Interleukin 1 Beta (IL1b)

Sign In for Pricing
View Details
HRP Linked Polyclonal Antibody to Interleukin 1 Beta (IL1b)
MBS2130080-06 5x 5 mL

HRP Linked Polyclonal Antibody to Interleukin 1 Beta (IL1b)

Sign In for Pricing
View Details