Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ω-Tbo-IT1

ω-Tbo-IT1 has been isolated from the venom of the Tibellus oblongus spider. ω-Tbo-IT1 is a selective blocker of insects calcium channels. It has been shown that ω-Tbo-IT1 has a potent insect toxicity with LD50 19 μg/g on house fly Musca domestica larvae and LD50 20 μg/g on juvenile Gromphadorhina portentosa cockroaches. Electrophysiological experiments revealed a reversible inhibition of evoked excitatory postsynaptic currents in blow fly Calliphora vicina neuromuscular junctions with an IC50 value 40 ± 10 nM.

Product Specifications

Specifications

Selective blocker of insects calcium channels

Target

Ca channels

Sequence

CASKNERCGNALYGTKGPGCCNGKCICRTVPRKGVNSCRCM

Peptide Number

ITO001

Disulfide Bonds

Cys1-Cys21; Cys8-Cys25; Cys20-Cys40

N Terminal Sequence

H

C Terminal Sequence

OH

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CK-5 Polyclonal Antibody
E-AB-10147-01 20 µL

CK-5 Polyclonal Antibody

Sign In for Pricing
View Details
CK-5 Polyclonal Antibody
E-AB-10147-02 60 µL

CK-5 Polyclonal Antibody

Sign In for Pricing
View Details
CK-5 Polyclonal Antibody
E-AB-10147-03 120 µL

CK-5 Polyclonal Antibody

Sign In for Pricing
View Details
CK-5 Polyclonal Antibody
E-AB-10147-04 200 µL

CK-5 Polyclonal Antibody

Sign In for Pricing
View Details
Ep-CAM / CD326 (Epithelial Marker) (rVU-1D9), CF640R conjugate, 0.1mg/mL
BNC401820-100 1x 100 µL

Ep-CAM / CD326 (Epithelial Marker) (rVU-1D9), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD19 (CVID3/429), 0.2mg/mL
BNUB0429-100 1x 100 µL

CD19 (CVID3/429), 0.2mg/mL

Sign In for Pricing
View Details