Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ω-Tbo-IT1

ω-Tbo-IT1 has been isolated from the venom of the Tibellus oblongus spider. ω-Tbo-IT1 is a selective blocker of insects calcium channels. It has been shown that ω-Tbo-IT1 has a potent insect toxicity with LD50 19 μg/g on house fly Musca domestica larvae and LD50 20 μg/g on juvenile Gromphadorhina portentosa cockroaches. Electrophysiological experiments revealed a reversible inhibition of evoked excitatory postsynaptic currents in blow fly Calliphora vicina neuromuscular junctions with an IC50 value 40 ± 10 nM.

Product Specifications

Specifications

Selective blocker of insects calcium channels

Target

Ca channels

Sequence

CASKNERCGNALYGTKGPGCCNGKCICRTVPRKGVNSCRCM

Peptide Number

ITO001

Disulfide Bonds

Cys1-Cys21; Cys8-Cys25; Cys20-Cys40

N Terminal Sequence

H

C Terminal Sequence

OH

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Kappa Light Chain (KLC709), 1mg/mL
BNUM0709-50 1x 50 µL

Human Kappa Light Chain (KLC709), 1mg/mL

Sign In for Pricing
View Details
2-Bromo-5-picoline-d3
TRC-B685572-1MG 1 mg

2-Bromo-5-picoline-d3

Sign In for Pricing
View Details
Tissue Genomic DNA, Colon: right
CD564145 5 µg

Tissue Genomic DNA, Colon: right

Sign In for Pricing
View Details
UBXN2B Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI1F7]
TA502631BM 100 µL

UBXN2B Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI1F7]

Sign In for Pricing
View Details
CBX3 Antibody
KC-6254-01 50 μL

CBX3 Antibody

Sign In for Pricing
View Details
CBX3 Antibody
KC-6254-02 100 µL

CBX3 Antibody

Sign In for Pricing
View Details