Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ω-agatoxin-IVA

ω-agatoxin-IVA (ω-AGA IVA) is a peptide originally isolated from funnel web-spider venom Agelenopsis aperta. This peptide is a specific blocker of P/Q-type calcium channel (Cav2.1) . It has been reported that ω-agatoxin IVA is a potent blocker of voltage-gated calcium channels in insect and vertebrate central neurons. The binding site for ω-agatoxin IVA has been localized in part to the extracellular S3–S4 loop in repeat IV of the α-1A Ca2+ channels, which is proximal to the S4 sensor domain. This is coherent with its functional effect (no pore-blocking activity, but gating modifier by a shift of channel activation towards more depolarized potentials) . This makes this toxin a voltage-dependent blocker of P/Q calcium channels.

Product Specifications

CAS Number

145017-83-0

Specifications

Blocker of P/Q-type calcium channel (Cav2.1)

Target

Ca channels

Sequence

KKKCIAKDYGRCKWGGTPCCRGRGCICSIMGTNCECKPRLIMEGLGLA

Peptide Number

11AGA001

Disulfide Bonds

Cys4-Cys20; Cys12-Cys25; Cys19-Cys36; Cys27-Cys34

N Terminal Sequence

H

C Terminal Sequence

OH

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human Aminoacylase 2 (ACY2)
RPU55923-01 50 µg

Recombinant Human Aminoacylase 2 (ACY2)

Sign In for Pricing
View Details
Recombinant Human Aminoacylase 2 (ACY2)
RPU55923-02 100 µg

Recombinant Human Aminoacylase 2 (ACY2)

Sign In for Pricing
View Details
Recombinant Human Aminoacylase 2 (ACY2)
RPU55923-03 1 mg

Recombinant Human Aminoacylase 2 (ACY2)

Sign In for Pricing
View Details
ANAPC7 Lentiviral Vector (Rat) (UbC) (pLenti-GIII-UbC)
LV621425 1.0 µg DNA

ANAPC7 Lentiviral Vector (Rat) (UbC) (pLenti-GIII-UbC)

Sign In for Pricing
View Details
Benzyl D-glucuronate
292771-01 25 mg

Benzyl D-glucuronate

Sign In for Pricing
View Details
Benzyl D-glucuronate
292771-02 50 mg

Benzyl D-glucuronate

Sign In for Pricing
View Details