Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Tamapin

Tamapin is a peptide toxin isolated from the venom of the Indian red scorpion Mesobuthus Tamulus. Tamapin is amidated at its C-terminal tyrosine residue. Tamapin binds to small conductance Ca2+-activated K+ channels (SK channels) with high affinity and inhibits SK channel-mediated currents in pyramidal neurons of the hippocampus as well as in cell lines expressing distinct SK channel subunits. Contrary to Apamin or Leiurotoxin-1 (Scyllatoxin), Tamapin is an excellent toxin to discriminate among SK channel subtypes because it presents different affinities for SK1 (42 nM), SK2 (24 pM) and SK3 (1.7 nM) channels. This toxin is also the most potent SK2 channel blocker characterized so far (IC50 for SK2 channels = 24 pM) .

Product Specifications

Specifications

Selective blocker of SK2 (KCa2.2) channels

Target

K channels

Sequence

AFCNLRRCELSCRSLGLLGKCIGEECKCVPY

Peptide Number

10TAM001

Disulfide Bonds

Cys3-Cys21; Cys8-Cys26; Cys12-Cys28

N Terminal Sequence

H

C Terminal Sequence

NH2

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GLS Knockout AGS Polyclonal Cells
ARG2873 1 Million

GLS Knockout AGS Polyclonal Cells

Sign In for Pricing
View Details
XMD16-5
C13307-01 5 mg

XMD16-5

Sign In for Pricing
View Details
XMD16-5
C13307-02 25 mg

XMD16-5

Sign In for Pricing
View Details
Caprine Actin Beta (ACTB) ELISA Kit-Competitive
EK1F586 96 Tests

Caprine Actin Beta (ACTB) ELISA Kit-Competitive

Sign In for Pricing
View Details
Fanapanel hydrate
orb1708172 2 mg

Fanapanel hydrate

Sign In for Pricing
View Details
Human TFCP2 Knockout HEK293T cell line
GTR15409901 1 Vial

Human TFCP2 Knockout HEK293T cell line

Sign In for Pricing
View Details