Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Tamapin

Tamapin is a peptide toxin isolated from the venom of the Indian red scorpion Mesobuthus Tamulus. Tamapin is amidated at its C-terminal tyrosine residue. Tamapin binds to small conductance Ca2+-activated K+ channels (SK channels) with high affinity and inhibits SK channel-mediated currents in pyramidal neurons of the hippocampus as well as in cell lines expressing distinct SK channel subunits. Contrary to Apamin or Leiurotoxin-1 (Scyllatoxin), Tamapin is an excellent toxin to discriminate among SK channel subtypes because it presents different affinities for SK1 (42 nM), SK2 (24 pM) and SK3 (1.7 nM) channels. This toxin is also the most potent SK2 channel blocker characterized so far (IC50 for SK2 channels = 24 pM) .

Product Specifications

Specifications

Selective blocker of SK2 (KCa2.2) channels

Target

K channels

Sequence

AFCNLRRCELSCRSLGLLGKCIGEECKCVPY

Peptide Number

10TAM001

Disulfide Bonds

Cys3-Cys21; Cys8-Cys26; Cys12-Cys28

N Terminal Sequence

H

C Terminal Sequence

NH2

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PQLC1, ID (PQLC1, PQ-loop repeat-containing protein 1) (MaxLight 550)
MBS6336837-01 0.1 mL

PQLC1, ID (PQLC1, PQ-loop repeat-containing protein 1) (MaxLight 550)

Sign In for Pricing
View Details
PQLC1, ID (PQLC1, PQ-loop repeat-containing protein 1) (MaxLight 550)
MBS6336837-02 5x 0.1 mL

PQLC1, ID (PQLC1, PQ-loop repeat-containing protein 1) (MaxLight 550)

Sign In for Pricing
View Details
Phospho-CDK1 (Ser39) Rabbit Polyclonal Antibody (Biotin)
orb501255 100 µL

Phospho-CDK1 (Ser39) Rabbit Polyclonal Antibody (Biotin)

Sign In for Pricing
View Details
Mouse Peptidase inhibitor 16 (PI16) ELISA Kit
AE27558MO-01 48 Tests

Mouse Peptidase inhibitor 16 (PI16) ELISA Kit

Sign In for Pricing
View Details
Mouse Peptidase inhibitor 16 (PI16) ELISA Kit
AE27558MO-02 96 Tests

Mouse Peptidase inhibitor 16 (PI16) ELISA Kit

Sign In for Pricing
View Details
1-Ethyl-3-methylimidazolium methylphosphonate
IL-0352-HP-0500 500 g

1-Ethyl-3-methylimidazolium methylphosphonate

Sign In for Pricing
View Details