Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TAMRA-ShK

TMR-ShK is a fluorescent (red) derivative of the well-known ShK toxin (Stichodactyla helianthus neurotoxin) isolated from the venom of the Carribean sea anemone Stoichactis helianthus. Wild-type ShK blocks potently Kv1.3 (KCNA3), Kv1.1 (KCNA1), Kv1.4 (KCNA4) and Kv1.6 (KCNA6) with a Kd value of 11 pM, 16 pM, 312 pM and 165 pM, respectively. The fluorescent TMR-labeled ShK blocks Kv1.3 and Kv1.1 with Kd values of 52 pM and 397 pM, respectively. TMR-ShK can be used to identify lymphocytes expressing Kv1.3 channels such as effective memory T cells (TEM) in the case of autoimmune diseases (type 1 diabetes, mellitus or rheumatoid arthritis) which overexpress Kv1.3 channels.

Product Specifications

Specifications

Selective blocker of Kv1.4

Target

K channels

Sequence

RSCIDTIPKSRCTAFQCKHSMKYRLSFCRKTCGTC

Peptide Number

SAT001

Disulfide Bonds

Cys3-Cys35; Cys12-Cys28; Cys17-Cys32

N Terminal Sequence

H

C Terminal Sequence

OH

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Mouse CD38 Protein
MBS8305200-01 0.01 mg

Recombinant Mouse CD38 Protein

Sign In for Pricing
View Details
Recombinant Mouse CD38 Protein
MBS8305200-02 0.05 mg

Recombinant Mouse CD38 Protein

Sign In for Pricing
View Details
Recombinant Mouse CD38 Protein
MBS8305200-03 0.5 mg

Recombinant Mouse CD38 Protein

Sign In for Pricing
View Details
Recombinant Mouse CD38 Protein
MBS8305200-04 5x 0.5 mg

Recombinant Mouse CD38 Protein

Sign In for Pricing
View Details
PIK3CA Rabbit Polyclonal Antibody
E10G12809 100 µL

PIK3CA Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
GCC2 (NM_181453) Human Untagged Clone
SC309432 10 µg

GCC2 (NM_181453) Human Untagged Clone

Sign In for Pricing
View Details