Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TAMRA-ShK

TMR-ShK is a fluorescent (red) derivative of the well-known ShK toxin (Stichodactyla helianthus neurotoxin) isolated from the venom of the Carribean sea anemone Stoichactis helianthus. Wild-type ShK blocks potently Kv1.3 (KCNA3), Kv1.1 (KCNA1), Kv1.4 (KCNA4) and Kv1.6 (KCNA6) with a Kd value of 11 pM, 16 pM, 312 pM and 165 pM, respectively. The fluorescent TMR-labeled ShK blocks Kv1.3 and Kv1.1 with Kd values of 52 pM and 397 pM, respectively. TMR-ShK can be used to identify lymphocytes expressing Kv1.3 channels such as effective memory T cells (TEM) in the case of autoimmune diseases (type 1 diabetes, mellitus or rheumatoid arthritis) which overexpress Kv1.3 channels.

Product Specifications

Specifications

Selective blocker of Kv1.4

Target

K channels

Sequence

RSCIDTIPKSRCTAFQCKHSMKYRLSFCRKTCGTC

Peptide Number

SAT001

Disulfide Bonds

Cys3-Cys35; Cys12-Cys28; Cys17-Cys32

N Terminal Sequence

H

C Terminal Sequence

OH

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

pCMV-SPORT6-Nelfa Plasmid
PVT57339 2 µg

pCMV-SPORT6-Nelfa Plasmid

Sign In for Pricing
View Details
ASF1A Protein Lysate
OCOA02058-20UG 20 µg

ASF1A Protein Lysate

Sign In for Pricing
View Details
CKB Polyclonal Antibody
MBS9132520-01 0.02 mL

CKB Polyclonal Antibody

Sign In for Pricing
View Details
CKB Polyclonal Antibody
MBS9132520-02 0.1 mL

CKB Polyclonal Antibody

Sign In for Pricing
View Details
CKB Polyclonal Antibody
MBS9132520-03 5x 0.1 mL

CKB Polyclonal Antibody

Sign In for Pricing
View Details
Recombinant Rabbit Interleukin-8 (IL8)
MBS954269-01 0.02 mg (E-Coli)

Recombinant Rabbit Interleukin-8 (IL8)

Sign In for Pricing
View Details