ShK – Stichodactyla toxin
ShK (Stichodactyla helianthus Neurotoxin) has been isolated from the venom of the Carribean sea anemone Stoichactis helianthus. ShK inhibits voltage-dependent potassium channels. It blocks Kv1.3 (KCNA3) potently and also Kv1.1 (KCNA1), Kv1.4 (KCNA4) and Kv1.6 (KCNA6) respectively with a Kd of 11 pM, 16 pM, 312 pM and 165 pM. Interestingly, it was also demonstrated that ShK potently inhibits the hKv3.2b channel with an IC50 value of approximately 0.6 nM
Product Specifications
CAS Number
165168-50-3
Specifications
Selective blocker of Kv1.3
Target
K channels
Sequence
RSCIDTIPKSRCTAFQCKHSMKYRLSFCRKTCGTC
Peptide Number
08SHK001
Disulfide Bonds
Cys3-Cys35; Cys12-Cys28; Cys17-Cys32
N Terminal Sequence
H
C Terminal Sequence
OH
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
sc-419526-LAC-2 200 µL
TCP-1 ε Lentiviral Activation Particles (m2)
Sign In for Pricing
View Details MBS6193434-01 0.1 mL
WFDC5 (PRG5, WAP1, WAP Four-disulfide Core Domain Protein 5, Putative Protease Inhibitor WAP1, p53-responsive Gene 5 Protein) (MaxLight 405)
Sign In for Pricing
View Details MBS6193434-02 5x 0.1 mL
WFDC5 (PRG5, WAP1, WAP Four-disulfide Core Domain Protein 5, Putative Protease Inhibitor WAP1, p53-responsive Gene 5 Protein) (MaxLight 405)
Sign In for Pricing
View Details 