Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ShK – Stichodactyla toxin

ShK (Stichodactyla helianthus Neurotoxin) has been isolated from the venom of the Carribean sea anemone Stoichactis helianthus. ShK inhibits voltage-dependent potassium channels. It blocks Kv1.3 (KCNA3) potently and also Kv1.1 (KCNA1), Kv1.4 (KCNA4) and Kv1.6 (KCNA6) respectively with a Kd of 11 pM, 16 pM, 312 pM and 165 pM. Interestingly, it was also demonstrated that ShK potently inhibits the hKv3.2b channel with an IC50 value of approximately 0.6 nM

Product Specifications

CAS Number

165168-50-3

Specifications

Selective blocker of Kv1.3

Target

K channels

Sequence

RSCIDTIPKSRCTAFQCKHSMKYRLSFCRKTCGTC

Peptide Number

08SHK001

Disulfide Bonds

Cys3-Cys35; Cys12-Cys28; Cys17-Cys32

N Terminal Sequence

H

C Terminal Sequence

OH

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Acyl Coenzyme A Synthetase Long Chain Family, Member 4 (ACSL4) ELISA Kit
EKU12214 96 Tests

Human Acyl Coenzyme A Synthetase Long Chain Family, Member 4 (ACSL4) ELISA Kit

Sign In for Pricing
View Details
Lentiviral human FAM135B shRNA (UAS) - Lentiviral human FAM135B shRNA (UAS, RFP) (25)
GTR15339650 1 Vial

Lentiviral human FAM135B shRNA (UAS) - Lentiviral human FAM135B shRNA (UAS, RFP) (25)

Sign In for Pricing
View Details
Anti-L1TD1 Antibody Picoband
MBS1759277-01 0.01 mg

Anti-L1TD1 Antibody Picoband

Sign In for Pricing
View Details
Anti-L1TD1 Antibody Picoband
MBS1759277-02 0.1 mg (Carrier Free)

Anti-L1TD1 Antibody Picoband

Sign In for Pricing
View Details
Anti-L1TD1 Antibody Picoband
MBS1759277-03 0.1 mg

Anti-L1TD1 Antibody Picoband

Sign In for Pricing
View Details
Anti-L1TD1 Antibody Picoband
MBS1759277-04 0.1 mg (Cy3)

Anti-L1TD1 Antibody Picoband

Sign In for Pricing
View Details