Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ShK – Stichodactyla toxin

ShK (Stichodactyla helianthus Neurotoxin) has been isolated from the venom of the Carribean sea anemone Stoichactis helianthus. ShK inhibits voltage-dependent potassium channels. It blocks Kv1.3 (KCNA3) potently and also Kv1.1 (KCNA1), Kv1.4 (KCNA4) and Kv1.6 (KCNA6) respectively with a Kd of 11 pM, 16 pM, 312 pM and 165 pM. Interestingly, it was also demonstrated that ShK potently inhibits the hKv3.2b channel with an IC50 value of approximately 0.6 nM

Product Specifications

CAS Number

165168-50-3

Specifications

Selective blocker of Kv1.3

Target

K channels

Sequence

RSCIDTIPKSRCTAFQCKHSMKYRLSFCRKTCGTC

Peptide Number

08SHK001

Disulfide Bonds

Cys3-Cys35; Cys12-Cys28; Cys17-Cys32

N Terminal Sequence

H

C Terminal Sequence

OH

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

IRX3 Antibody
MBS7105669-01 0.05 mg

IRX3 Antibody

Sign In for Pricing
View Details
IRX3 Antibody
MBS7105669-02 0.1 mg

IRX3 Antibody

Sign In for Pricing
View Details
IRX3 Antibody
MBS7105669-03 5x 0.1 mg

IRX3 Antibody

Sign In for Pricing
View Details
Mouse TG ELISA Kit
EMT0042 96 Tests

Mouse TG ELISA Kit

Sign In for Pricing
View Details
RWDD2B (NM_016940) Human Tagged ORF Clone Lentiviral Particle
RC203057L4V 200 µL

RWDD2B (NM_016940) Human Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
6-Bromo-6-deoxy-D-glucopyranose (a/b mixture)
TRC-B687755-50MG 50 mg

6-Bromo-6-deoxy-D-glucopyranose (a/b mixture)

Sign In for Pricing
View Details