Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ShK – Stichodactyla toxin

ShK (Stichodactyla helianthus Neurotoxin) has been isolated from the venom of the Carribean sea anemone Stoichactis helianthus. ShK inhibits voltage-dependent potassium channels. It blocks Kv1.3 (KCNA3) potently and also Kv1.1 (KCNA1), Kv1.4 (KCNA4) and Kv1.6 (KCNA6) respectively with a Kd of 11 pM, 16 pM, 312 pM and 165 pM. Interestingly, it was also demonstrated that ShK potently inhibits the hKv3.2b channel with an IC50 value of approximately 0.6 nM

Product Specifications

CAS Number

165168-50-3

Specifications

Selective blocker of Kv1.3

Target

K channels

Sequence

RSCIDTIPKSRCTAFQCKHSMKYRLSFCRKTCGTC

Peptide Number

08SHK001

Disulfide Bonds

Cys3-Cys35; Cys12-Cys28; Cys17-Cys32

N Terminal Sequence

H

C Terminal Sequence

OH

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CXADR Reference Antibody
orb1806233-01 100 µg

CXADR Reference Antibody

Sign In for Pricing
View Details
CXADR Reference Antibody
orb1806233-02 1 mg

CXADR Reference Antibody

Sign In for Pricing
View Details
Monoclonal KRT18 / CK18 / Cytokeratin 18 Antibody (clone Ks 18.04, FITC), Clone: Ks 18.04
APR17072G 0.05ml

Monoclonal KRT18 / CK18 / Cytokeratin 18 Antibody (clone Ks 18.04, FITC), Clone: Ks 18.04

Sign In for Pricing
View Details
RGD1305184 3'UTR GFP Stable Cell Line
TU267571 1.0 mL

RGD1305184 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
Ahsa2 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 3)
K4296808 1.0 µg DNA

Ahsa2 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 3)

Sign In for Pricing
View Details
10μL Filter Pipette Tips, Sterile, DNase and RNase Free, Endotoxin Free, 96pcs*50racks/Carton
21081101 4800 PCS

10μL Filter Pipette Tips, Sterile, DNase and RNase Free, Endotoxin Free, 96pcs*50racks/Carton

Sign In for Pricing
View Details