Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ShK – Stichodactyla toxin

ShK (Stichodactyla helianthus Neurotoxin) has been isolated from the venom of the Carribean sea anemone Stoichactis helianthus. ShK inhibits voltage-dependent potassium channels. It blocks Kv1.3 (KCNA3) potently and also Kv1.1 (KCNA1), Kv1.4 (KCNA4) and Kv1.6 (KCNA6) respectively with a Kd of 11 pM, 16 pM, 312 pM and 165 pM. Interestingly, it was also demonstrated that ShK potently inhibits the hKv3.2b channel with an IC50 value of approximately 0.6 nM

Product Specifications

CAS Number

165168-50-3

Specifications

Selective blocker of Kv1.3

Target

K channels

Sequence

RSCIDTIPKSRCTAFQCKHSMKYRLSFCRKTCGTC

Peptide Number

08SHK001

Disulfide Bonds

Cys3-Cys35; Cys12-Cys28; Cys17-Cys32

N Terminal Sequence

H

C Terminal Sequence

OH

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

IPP (Intracisternal A Particle-promoted Polypeptide, KLHL27) (HRP)
MBS6182974-01 0.1 mL

IPP (Intracisternal A Particle-promoted Polypeptide, KLHL27) (HRP)

Sign In for Pricing
View Details
IPP (Intracisternal A Particle-promoted Polypeptide, KLHL27) (HRP)
MBS6182974-02 5x 0.1 mL

IPP (Intracisternal A Particle-promoted Polypeptide, KLHL27) (HRP)

Sign In for Pricing
View Details
PKC mu Rabbit mAb (AMR11874N)
AMR11874N-01 50 µL

PKC mu Rabbit mAb (AMR11874N)

Sign In for Pricing
View Details
PKC mu Rabbit mAb (AMR11874N)
AMR11874N-02 100 µL

PKC mu Rabbit mAb (AMR11874N)

Sign In for Pricing
View Details
PKC mu Rabbit mAb (AMR11874N)
AMR11874N-03 200 µL

PKC mu Rabbit mAb (AMR11874N)

Sign In for Pricing
View Details
CSFV E2 Protein Antibody HRP Conjugated
C03872H 100 µL

CSFV E2 Protein Antibody HRP Conjugated

Sign In for Pricing
View Details