Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ProTx-I

Protoxin I (ProTx-I; β-theraphotoxin-Tp1a) is a toxin that was originally isolated from the venom of Thrixopelma pruriens (Peruvian green velvet tarantula) . This toxin reversibly inhibits the tetrodotoxin (TTX) -resistant channel Nav1.8 (IC50 = 27 nM) and Nav1.2, Nav1.5 and Nav1.7 with IC50 values between 50 and 100 nM. Furthermore, ProTx-I shifts the voltage dependence activity of T-type Cav3.1 channels (IC50= 50 nM) without affecting the voltage dependence of inactivation. ProTx-I is a valuable tool to discriminate between Cav3.1 and Cav3.2

Product Specifications

Specifications

Blocker of voltage-gated sodium channels and T-type Cav

Target

Na channels

Sequence

ECRYWLGGCSAGQTCCKHLVCSRRHGWCVWDGTFS

Peptide Number

12PTX001

Disulfide Bonds

Cys2-Cys16; Cys9-Cys21; Cys15-Cys28

N Terminal Sequence

H

C Terminal Sequence

OH

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

DKKL1 rabbit pAb Antibody
orb774068-01 50 μL

DKKL1 rabbit pAb Antibody

Sign In for Pricing
View Details
DKKL1 rabbit pAb Antibody
orb774068-02 100 µL

DKKL1 rabbit pAb Antibody

Sign In for Pricing
View Details
3-Nitroalinine 1000ug/mL in MeOH - 1ML
REAZO041 1 mL

3-Nitroalinine 1000ug/mL in MeOH - 1ML

Sign In for Pricing
View Details
Defb28 (NM_001037502) Mouse Tagged ORF Clone Lentiviral Particle
MR224910L4V 200 µL

Defb28 (NM_001037502) Mouse Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
RBITC [Rhodamine B 5-isothiocyanate]
E37F 418-500 mg 500 mg

RBITC [Rhodamine B 5-isothiocyanate]

Sign In for Pricing
View Details
TUT1 Antibody
25-532 100 µL

TUT1 Antibody

Sign In for Pricing
View Details