Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Phrixotoxin-3

Phrixotoxin-3 (PaurTx3 or Beta-theraphotoxin-Ps1a) is a valuable pharmacological tool to study voltage-gated sodium channels. Phrixotoxin-3, originally issued from the venom of the tarantula phrixotrichus auratus, has been shown to inhibit Nav1.1, Nav1.2, Nav1.3, Nav1.4 and Nav1.5 with respective IC50 values of 610 nM, 0.6 nM, 42 nM, 288 nM and 72 nM. It is thus considered as one of the most potent and almost selective modulator of Nav1.2.

Product Specifications

Specifications

Selective blocker of Nav1.2

Target

Na channels

Sequence

DCLGFLWKCNPSNDKCCRPNLVCSRKDKWCKYQI

Peptide Number

13PHX003

Disulfide Bonds

Cys2-Cys17; Cys9-Cys23; ; Cys16-Cys30

N Terminal Sequence

H

C Terminal Sequence

OH

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD84 (153-4D9), CF488A conjugate, 0.1mg/mL
BNC881049-100 1x 100 µL

CD84 (153-4D9), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Biotin-Linked Rabbit Anti-Cavia IgG Polyclonal Antibody
TRV-0006217 1 mL

Biotin-Linked Rabbit Anti-Cavia IgG Polyclonal Antibody

Sign In for Pricing
View Details
RGD1306954 ORF Vector (Rat) (pORF)
ORF074838 1.0 µg DNA

RGD1306954 ORF Vector (Rat) (pORF)

Sign In for Pricing
View Details
PE-FineTest®594 Mouse IgG1, κ Isotype Control (MOPC-21)
PE5-30076U-01 25 µg

PE-FineTest®594 Mouse IgG1, κ Isotype Control (MOPC-21)

Sign In for Pricing
View Details
PE-FineTest®594 Mouse IgG1, κ Isotype Control (MOPC-21)
PE5-30076U-02 100 µg

PE-FineTest®594 Mouse IgG1, κ Isotype Control (MOPC-21)

Sign In for Pricing
View Details
17α-Dihydro Equilin
009852-01 1 mg

17α-Dihydro Equilin

Sign In for Pricing
View Details