Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Phrixotoxin-3

Phrixotoxin-3 (PaurTx3 or Beta-theraphotoxin-Ps1a) is a valuable pharmacological tool to study voltage-gated sodium channels. Phrixotoxin-3, originally issued from the venom of the tarantula phrixotrichus auratus, has been shown to inhibit Nav1.1, Nav1.2, Nav1.3, Nav1.4 and Nav1.5 with respective IC50 values of 610 nM, 0.6 nM, 42 nM, 288 nM and 72 nM. It is thus considered as one of the most potent and almost selective modulator of Nav1.2.

Product Specifications

Specifications

Selective blocker of Nav1.2

Target

Na channels

Sequence

DCLGFLWKCNPSNDKCCRPNLVCSRKDKWCKYQI

Peptide Number

13PHX003

Disulfide Bonds

Cys2-Cys17; Cys9-Cys23; ; Cys16-Cys30

N Terminal Sequence

H

C Terminal Sequence

OH

More Discoveries

Explore Other Products

Browse additional items from our catalog

FAP Rabbit pAb
E47R41286 100 µL

FAP Rabbit pAb

Sign In for Pricing
View Details
LYN Protein Lysate (Human) with C-Ha Tag
27835031 100 µg

LYN Protein Lysate (Human) with C-Ha Tag

Sign In for Pricing
View Details
RIGI Antibody, mAb, Rabbit
A03801-100 100 µL

RIGI Antibody, mAb, Rabbit

Sign In for Pricing
View Details
KTN1 Rabbit pAb
E2512456 100 µL

KTN1 Rabbit pAb

Sign In for Pricing
View Details
BAY 11-7082
MBS696309-01 10 mg

BAY 11-7082

Sign In for Pricing
View Details
BAY 11-7082
MBS696309-02 25 mg

BAY 11-7082

Sign In for Pricing
View Details