Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Obtustatin

Obtustatin is a 41 amino acid disintegrin peptide isolated from the venom of the Vipera lebetina obtusa. It is a potent (IC50 = 2 nM) and selective inhibitor of the binding of α1β1 integrin to collagen IV. Contrary to other known disintegrins, it does not contain the classical RGD sequence. Obtustatin does not show inhibitory activity toward other integrins, including α2β1, αIIbβ3, αvβ3, α4β1, α5β1, α6β1, and α9β1, α4β7 integrins. Obtustatin potently inhibits angiogenesis in chicken and in mouse model and reduces tumor development by half.

Product Specifications

Specifications

Inhibitor of the binding of α1β1 integrin to collagen IV

Target

Integrins

Sequence

CTTGPCCRQCKLKPAGTTCWKTSLTSHYCTGKSCDCPLYPG

Peptide Number

10OBT001

Disulfide Bonds

Cys1-Cys10; Cys6-Cys29; Cys7-Cys34 ; Cys19-Cys36

N Terminal Sequence

H

C Terminal Sequence

OH

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SR 3677 dihydrochloride 5mg
A12674-5 5 mg

SR 3677 dihydrochloride 5mg

Sign In for Pricing
View Details
Rat Anaphase promoting complex subunit 5 (ANAPC5) ELISA kit
GTR10417638 96 Well

Rat Anaphase promoting complex subunit 5 (ANAPC5) ELISA kit

Sign In for Pricing
View Details
Easypro Human Microalbuminuria (MAU) ELISA Kit
FY-EH2740S 96 Well

Easypro Human Microalbuminuria (MAU) ELISA Kit

Sign In for Pricing
View Details
Horse Fetuin A, FETU-A ELISA Kit
MBS1607769-01 48 Well

Horse Fetuin A, FETU-A ELISA Kit

Sign In for Pricing
View Details
Horse Fetuin A, FETU-A ELISA Kit
MBS1607769-02 96 Well

Horse Fetuin A, FETU-A ELISA Kit

Sign In for Pricing
View Details
Horse Fetuin A, FETU-A ELISA Kit
MBS1607769-03 5x 96 Well

Horse Fetuin A, FETU-A ELISA Kit

Sign In for Pricing
View Details