Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MitTx

MitTx is a peptide isolated from the Venom of the Texas coral snake Micrurus tener tener. MitTx is a selective agonist for acid-sensing ion channels 1 (ASIC1s) and produces a similar effect than pH drops. MitTx activates both ASIC1a & ASIC1b with a higher selectivity for ASIC1a (EC50 = 9.4 nM) compared to the ASIC1b (EC50= 23 nM) . MitTx also demonstrates an activity for ASIC3 with a lower potency (EC50=830 nM) .The venom toxin MitTx is an heterodimer composed of an α subunit of ~ 7 kDa and a β subunit of ~ 13.5 kDa. These two subunits when isolated do not present activity against ASIC channels. In vivo, the heterodimer elicits a robust pain-related behavior in mice by activation of ASIC1 channels on capsaicin-sensitive nerve fibers

Product Specifications

Specifications

ASIC1a/1b agonist

Target

ASIC channels

Sequence

MitTx-α subunit: QIRPAFCYEDPPFFQKCGAFVDSYYFNRSRITCVHFFYGQCDVNQNHFTTMSECNRVCHG MitTx-β subunit: NLNQFRLMIKCTNDRVWADFVDYGCYCVARDSNTPVDDLDRCCQAQKQCYDEAVKVHGCKPL VMFYSFECRYLASDLDCSGNNTKCRNFVCNCDRTATLCILTATYNRNNHKIDPSRCQ

Peptide Number

MTX002

Disulfide Bonds

Mit-αsubunit:Cys31-Cys82; Cys41-Cys65; Cys57-Cys78/Mit-βsubunit:Cys41-Cys100; Cys55-Cys148; Cys57-Cys73; Cys72-Cys130; Cys79-Cys123; Cys89-Cys116; Cys109-Cys121

N Terminal Sequence

H

C Terminal Sequence

OH

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Sestrin 1 (SESN1) Antibody Pair Kit (with Standard)
MBS2103468-01 5x 96 Tests

Mouse Sestrin 1 (SESN1) Antibody Pair Kit (with Standard)

Sign In for Pricing
View Details
Mouse Sestrin 1 (SESN1) Antibody Pair Kit (with Standard)
MBS2103468-02 5x 96 Tests + MBS2090685 (Ab Pairs Support Pack 1,5x 96 Tests)

Mouse Sestrin 1 (SESN1) Antibody Pair Kit (with Standard)

Sign In for Pricing
View Details
Mouse Sestrin 1 (SESN1) Antibody Pair Kit (with Standard)
MBS2103468-03 10x 96 Tests

Mouse Sestrin 1 (SESN1) Antibody Pair Kit (with Standard)

Sign In for Pricing
View Details
Mouse Sestrin 1 (SESN1) Antibody Pair Kit (with Standard)
MBS2103468-04 10x 96 Tests + MBS2090685 (Ab Pairs Support Pack 1, 10x 96 Tests)

Mouse Sestrin 1 (SESN1) Antibody Pair Kit (with Standard)

Sign In for Pricing
View Details
2-n-Propyl-4-methyl-6- (1-methylbenzimidazol-2-yl) -benzimidazole
P9052-55T 100 mg

2-n-Propyl-4-methyl-6- (1-methylbenzimidazol-2-yl) -benzimidazole

Sign In for Pricing
View Details
SRC, phosphorylated (Tyr419) (Proto-oncogene Tyrosine-protein Kinase Src, p60-Src, c-Src, Proto-oncogene c-Src, pp60c-src, SRC1) (MaxLight 550) discontinued
S6500-10E-ML550 100 µL

SRC, phosphorylated (Tyr419) (Proto-oncogene Tyrosine-protein Kinase Src, p60-Src, c-Src, Proto-oncogene c-Src, pp60c-src, SRC1) (MaxLight 550) discontinued

Sign In for Pricing
View Details