Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Maurotoxin

Maurotoxin is a component of the venom of Scorpio maurus palmatus. Maurotoxin is a member of the α-KTx6.2 scorpion toxin family. It blocks voltage-gated potassium channels (KV1.1/KCNA1, KV1.2/KCNA2, and KV1.3/KCNA3) and inhibits apamin-sensitive small conductance calcium-activated channels (SK channels), particularly KCa3.1 (IKca1, SK4) . The blockage of Kv1.2 occurs with high affinity.

Product Specifications

Specifications

Kv and SK channels blocker

Target

K channels

Sequence

VSCTGSKDCYAPCRKQTGCPNAKCINKSCKCYGC

Peptide Number

08MAR001

Disulfide Bonds

Cys3-Cys24; Cys9-Cys29; Cys13-Cys19; Cys31-Cys34

N Terminal Sequence

H

C Terminal Sequence

NH2

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human RANBP1 AssayLite™ Antibody (FITC Conjugate)
33315-05141 2x 75 µg

Human RANBP1 AssayLite™ Antibody (FITC Conjugate)

Sign In for Pricing
View Details
Rabbit Ventricular Cardiomyocytes
RPC-856 5x 10^5

Rabbit Ventricular Cardiomyocytes

Sign In for Pricing
View Details
DNAJB6 Antibody, HRP conjugated
MBS7049417-01 0.05 mg

DNAJB6 Antibody, HRP conjugated

Sign In for Pricing
View Details
DNAJB6 Antibody, HRP conjugated
MBS7049417-02 0.1 mg

DNAJB6 Antibody, HRP conjugated

Sign In for Pricing
View Details
DNAJB6 Antibody, HRP conjugated
MBS7049417-03 5x 0.1 mg

DNAJB6 Antibody, HRP conjugated

Sign In for Pricing
View Details
GS1 Lentiviral Activation Particles (h2)
sc-405996-LAC-2 200 µL

GS1 Lentiviral Activation Particles (h2)

Sign In for Pricing
View Details