Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Mambalgin-1

Mambalgin-1 was initially isolated by Sylvie Diochot and collaborators from the venom of the black mamba (Dendroaspis polylepis polylepis) . Mambalgin-1 is a potent and selective blocker of acid-sensing ion channels (ASIC) . ASIC channels have been demonstrated to be implied in pain pathways and appear to be promising therapeutic targets. Mambalgin-1 rapidly and reversibly inhibits recombinant homomeric ASIC1a (IC50=55 nM) and heteromeric ASIC1a+ASIC2a (IC50=246 nM) or ASIC1a+ASIC2b channels (IC50=61 nM) but also human channels hASIC1b (IC50=192 nM) and hASIC1a+hASIC1b (IC50=72nM) .Mambalgin-1 belongs to the family of three-finger toxins and has no sequence/structural homology with either PcTx1 or APETx2. Mambalgin-1 differs from mambalgin-2 by one amino acid. Both have demonstrated a similar activity. Mambalgin-1 has no effect on ASIC2a, ASIC3, ASIC1a+ASIC3 and ASIC1b+ASIC3 channels, as well as on TRPV1, P2X2,5-HT3A, Nav1.8, Cav3.2 and Kv1.2 channels.

Product Specifications

Specifications

ASIC1a & 1b channel blocker

Target

ASIC channels

Sequence

LKCYQHGKVVTCHRDMKFCYHNTGMPFRNLKLILQGCSSSCSETENNKCCSTDRCNK

Peptide Number

MAM001

Disulfide Bonds

Cys3-Cys19; Cys12-Cys37; Cys41-Cys49; Cys50-Cys55

N Terminal Sequence

H

C Terminal Sequence

OH

More Discoveries

Explore Other Products

Browse additional items from our catalog

Optineurin/OPTN Mouse Monoclonal Antibody (FITC)
orb2610175 100 µg

Optineurin/OPTN Mouse Monoclonal Antibody (FITC)

Sign In for Pricing
View Details
(S)-(-)-Malic-2,3,3-d3 Acid
M159506 10 mg

(S)-(-)-Malic-2,3,3-d3 Acid

Sign In for Pricing
View Details
Mouse Bnc1 Pre-designed siRNA Set B
SI101496B 1 Each

Mouse Bnc1 Pre-designed siRNA Set B

Sign In for Pricing
View Details
Recombinant Human Ameloblastin/AMBN (C-6His)
C947-10ug 10 µg

Recombinant Human Ameloblastin/AMBN (C-6His)

Sign In for Pricing
View Details
Rhizopus nigricans Allergen
50-91 1 Each

Rhizopus nigricans Allergen

Sign In for Pricing
View Details
TMEM106A Antibody, FITC conjugated
A36750-50UG 50 µg

TMEM106A Antibody, FITC conjugated

Sign In for Pricing
View Details