Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Leiurotoxin-1

Scyllatoxin (Leiurotoxin-1) is a neurotoxin that was originally isolated from Leiurus quinquestriatus hebraeus. Scyllatoxin binds and blocks SK channels (small conductance Ca2+-activated K+ channels) in the brain and spinal cord and inhibits them.

Product Specifications

CAS Number

116235-63-3

Specifications

SK channels blocker

Target

K channels

Sequence

AFCNLRMCQLSCRSLGLLGKCIGDKCECVKH

Peptide Number

10LEI001

Disulfide Bonds

Cys3-Cys21; Cys8-Cys26; Cys12-Cys28

N Terminal Sequence

H

C Terminal Sequence

NH2

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rat A Disintegrin And Metalloproteinase With Thrombospondin 7 (ADAMTS7) ELISA Kit
RDR-ADAMTS7-Ra-48Tests 48 Tests

Rat A Disintegrin And Metalloproteinase With Thrombospondin 7 (ADAMTS7) ELISA Kit

Sign In for Pricing
View Details
Lentiviral mouse Asprv1 shRNA (UAS) - Lentiviral mouse Asprv1 shRNA (UAS) (100)
GTR15196122 1 Vial

Lentiviral mouse Asprv1 shRNA (UAS) - Lentiviral mouse Asprv1 shRNA (UAS) (100)

Sign In for Pricing
View Details
PCDH7 Mouse Monoclonal Antibody [Clone ID: OTI1F9]
CF505443 100 µg

PCDH7 Mouse Monoclonal Antibody [Clone ID: OTI1F9]

Sign In for Pricing
View Details
Human AHI1 Knockout A549 cell line
GTR15403344 1 Vial

Human AHI1 Knockout A549 cell line

Sign In for Pricing
View Details
TIGD6 rabbit pAb
UB-GEN-9762 100 µL

TIGD6 rabbit pAb

Sign In for Pricing
View Details
Clostridium difficile toxin B Antibody
ND-R0166 1 Each

Clostridium difficile toxin B Antibody

Sign In for Pricing
View Details