Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Leiurotoxin-1

Scyllatoxin (Leiurotoxin-1) is a neurotoxin that was originally isolated from Leiurus quinquestriatus hebraeus. Scyllatoxin binds and blocks SK channels (small conductance Ca2+-activated K+ channels) in the brain and spinal cord and inhibits them.

Product Specifications

CAS Number

116235-63-3

Specifications

SK channels blocker

Target

K channels

Sequence

AFCNLRMCQLSCRSLGLLGKCIGDKCECVKH

Peptide Number

10LEI001

Disulfide Bonds

Cys3-Cys21; Cys8-Cys26; Cys12-Cys28

N Terminal Sequence

H

C Terminal Sequence

NH2

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Phospho-c-PLA2  (Ser505)  Antibody
ABF3329 100 µg

Phospho-c-PLA2 (Ser505) Antibody

Sign In for Pricing
View Details
Recombinant Mouse SMOC2 Protein, N-GST & C-His
MBS1579149-01 0.1 mg

Recombinant Mouse SMOC2 Protein, N-GST & C-His

Sign In for Pricing
View Details
Recombinant Mouse SMOC2 Protein, N-GST & C-His
MBS1579149-02 1 mg

Recombinant Mouse SMOC2 Protein, N-GST & C-His

Sign In for Pricing
View Details
Recombinant Mouse SMOC2 Protein, N-GST & C-His
MBS1579149-03 5x 1 mg

Recombinant Mouse SMOC2 Protein, N-GST & C-His

Sign In for Pricing
View Details
Anti-Olfactory receptor 6K2 Antibody
A16904 100 µL

Anti-Olfactory receptor 6K2 Antibody

Sign In for Pricing
View Details
2,6-Diazabicyclo[3.2.1]octane-2-carboxylic acid 1,1-dimethylethyl ester
JH920117 1 Each

2,6-Diazabicyclo[3.2.1]octane-2-carboxylic acid 1,1-dimethylethyl ester

Sign In for Pricing
View Details