Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Latartoxin-1a

Latartoxin-1a (U1-zodatoxin-Lt1a, LtTx-1a) has been isolated from the venom of Lachesana tarabaevi spider. It has been described to have insecticidal properties by inducing paralysis and death in some insects.

Product Specifications

Specifications

Insects paralysis and death

Target

Insectisides

Sequence

ECIPTKHDCTNDRKNCCPGHECKCYNTQIGGSKKEQCGCKKSLLAKAKNFGGKVITIFKA

Peptide Number

LAT001

Disulfide Bonds

Cys1-Cys4; Cys2-Cys5; Cys3-Cys8; Cys6-Cys7

N Terminal Sequence

H

C Terminal Sequence

OH

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-Calpain 3/CAPN3 Antibody Picoband® (Biotine Conjugate)
A02170-2-Biotin 100 µg/Vial

Anti-Calpain 3/CAPN3 Antibody Picoband® (Biotine Conjugate)

Sign In for Pricing
View Details
Rabbit Anti-Human HEXIM1 pAb
PA14348-01 50 μL

Rabbit Anti-Human HEXIM1 pAb

Sign In for Pricing
View Details
Rabbit Anti-Human HEXIM1 pAb
PA14348-02 100 μL

Rabbit Anti-Human HEXIM1 pAb

Sign In for Pricing
View Details
MAP2K4 Knockout Cell Lysate
ABC-KC1093 100 µg

MAP2K4 Knockout Cell Lysate

Sign In for Pricing
View Details
NAALADL2 Antibody Blocking Peptide
orb1508733 500 µg

NAALADL2 Antibody Blocking Peptide

Sign In for Pricing
View Details
Magic™ Recombinant Mouse Hfe Membrane Protein in Virus-Like PaRoom Temperatureicles (MP-VLPs)
S01YF-0622-KX109 Each

Magic™ Recombinant Mouse Hfe Membrane Protein in Virus-Like PaRoom Temperatureicles (MP-VLPs)

Sign In for Pricing
View Details