Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Huwentoxin-XVI

Huwentoxin-XVI is a 39 amino acids peptide that was discovered from the venom of the Chinese tarantula Ornithoctonus huwena. Huwentoxin-XVI was shown to be a potent blocker of HVA N-type calcium channels with an IC50 value of 60 nM in rat DRG. The blocking effect appears to be similar to that of ω-conotoxin-GVIA and ω-conotoxin-MVIIA. Neverthelss, Huwentoxin-XVI differs from GVIA and MVIIA thanks to its greater reversibility and its higher selectivity for N-type over P/Q type than MVIIA.

Product Specifications

Specifications

Selective blocker of N-type Ca2+ channels

Target

Ca channels

Sequence

CIGEGVPCDENDPRCCSGLVCLKPTLHGIWYKSYYCYKK

Peptide Number

HWT016

Disulfide Bonds

Cys1-Cys16; Cys8-Cys21; Cys15-Cys36

N Terminal Sequence

H

C Terminal Sequence

OH

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MEF2A CRISPR Knock Out 293T Cell Line (Human)
28322141 1x 10^6 Cells / 1.0 mL

MEF2A CRISPR Knock Out 293T Cell Line (Human)

Sign In for Pricing
View Details
THT-59-362-10 Pre-sized Labels for Printers
146171 10000 Pack (5000 Label (s) x 2 Roll)

THT-59-362-10 Pre-sized Labels for Printers

Sign In for Pricing
View Details
FAM161A antibody - middle region
MBS3214794-01 0.1 mL

FAM161A antibody - middle region

Sign In for Pricing
View Details
FAM161A antibody - middle region
MBS3214794-02 5x 0.1 mL

FAM161A antibody - middle region

Sign In for Pricing
View Details
DHRS1 Rabbit Polyclonal Antibody (Fluoro647)
orb3129616 100 µg

DHRS1 Rabbit Polyclonal Antibody (Fluoro647)

Sign In for Pricing
View Details
Anti-Alpha-1-Antitrypsin (A1AT)
FY-AB49364-01 1 mL

Anti-Alpha-1-Antitrypsin (A1AT)

Sign In for Pricing
View Details