Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Huwentoxin-XVI

Huwentoxin-XVI is a 39 amino acids peptide that was discovered from the venom of the Chinese tarantula Ornithoctonus huwena. Huwentoxin-XVI was shown to be a potent blocker of HVA N-type calcium channels with an IC50 value of 60 nM in rat DRG. The blocking effect appears to be similar to that of ω-conotoxin-GVIA and ω-conotoxin-MVIIA. Neverthelss, Huwentoxin-XVI differs from GVIA and MVIIA thanks to its greater reversibility and its higher selectivity for N-type over P/Q type than MVIIA.

Product Specifications

Specifications

Selective blocker of N-type Ca2+ channels

Target

Ca channels

Sequence

CIGEGVPCDENDPRCCSGLVCLKPTLHGIWYKSYYCYKK

Peptide Number

HWT016

Disulfide Bonds

Cys1-Cys16; Cys8-Cys21; Cys15-Cys36

N Terminal Sequence

H

C Terminal Sequence

OH

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mmu-miR-7016-5p inhibitor
HY-RI03769-01 5 nmol

Mmu-miR-7016-5p inhibitor

Sign In for Pricing
View Details
Mmu-miR-7016-5p inhibitor
HY-RI03769-02 20 nmol

Mmu-miR-7016-5p inhibitor

Sign In for Pricing
View Details
Abcb10 antibody
70R-8569 100 µL

Abcb10 antibody

Sign In for Pricing
View Details
Caprisil C8-X (2) HPLC Column, 5 µm, 100 Å, CB555-C8-X (2) x 100 mm
CB255-C8-X (2) 5 µm

Caprisil C8-X (2) HPLC Column, 5 µm, 100 Å, CB555-C8-X (2) x 100 mm

Sign In for Pricing
View Details
Recombinant Buchnera aphidicola subsp. Schizaphis graminum Threonine--tRNA ligase (thrS), partial
MBS1246148 Inquire

Recombinant Buchnera aphidicola subsp. Schizaphis graminum Threonine--tRNA ligase (thrS), partial

Sign In for Pricing
View Details
NCL siRNA (Human)
MBS828599-01 15 nmol

NCL siRNA (Human)

Sign In for Pricing
View Details