Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Huwentoxin-I

Huwentoxin-I (HwTx-I) is a neurotoxin that was originally isolated from the venom of the Chinese bird spider Ornithoctonus huwena. Huwentoxin-I is known to be an inhibitor of tetrodotoxin-sensitive voltage-gated sodium channels (TTX-S) (IC50 ~ 50 nM) and N-type voltage-sensitive calcium channels (IC50 ~ 100 nM) in mammalian DRG, hippocampus and insect’s DUM neurons. It has only a very weak effect on L-type calcium channels, no effect on TTX-R channels and has virtually no effect on muscle sodium channels. The selectivity of Huwentoxin-I for calcium channels appears to be higher than ω-conotoxin MVIIA and equivalent to ω-conotoxin GVIA. Huwentoxin-I demonstrated an antinociceptive effect in the rat model of the formalin test when administrated intrathecally (ED50 ~ 0.28 µg/kg), without side effects of the ones led by ω-conotoxin MVIIA.

Product Specifications

Specifications

Blocker of N-type Ca2+ channel and TTX-S channels

Target

Na channels

Sequence

ACKGVFDACTPGKNECCPNRVCSDKHKWCKWKL

Peptide Number

07HWT001

Disulfide Bonds

Cys2-Cys17; Cys9-Cys22; Cys16-Cys29

N Terminal Sequence

H

C Terminal Sequence

OH

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TRIM32 Protein Vector (Mouse) (pPM-C-HA)
PV241504 500 ng

TRIM32 Protein Vector (Mouse) (pPM-C-HA)

Sign In for Pricing
View Details
RPL23, ID (RPL23, 60S ribosomal protein L23, 60S ribosomal protein L17)
041200 200 µL

RPL23, ID (RPL23, 60S ribosomal protein L23, 60S ribosomal protein L17)

Sign In for Pricing
View Details
Human Glucose 6 Phosphate Isomerase (GPI) ELISA Kit
RD-AMF-Hu-96Tests 96 Tests

Human Glucose 6 Phosphate Isomerase (GPI) ELISA Kit

Sign In for Pricing
View Details
Human PMP22 (Peripheral Myelin Protein 22) ELISA Kit
MBS8803471-01 48 Well

Human PMP22 (Peripheral Myelin Protein 22) ELISA Kit

Sign In for Pricing
View Details
Human PMP22 (Peripheral Myelin Protein 22) ELISA Kit
MBS8803471-02 96 Well

Human PMP22 (Peripheral Myelin Protein 22) ELISA Kit

Sign In for Pricing
View Details
Human PMP22 (Peripheral Myelin Protein 22) ELISA Kit
MBS8803471-03 5x 96 Well

Human PMP22 (Peripheral Myelin Protein 22) ELISA Kit

Sign In for Pricing
View Details