Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Hainantoxin-IV

Hainantoxin-IV (HNTX-IV) is a peptide that was originally isolated from the venom of the Chinese bird spider Ornithoctonus hainana Liang (Selenocosmia hainana Liang) . It has been reported that this peptide is a potent antagonist of tetrodotoxin-sensitive (TTX-S) voltage-gated sodium channels (VGSCs) . Hainantoxin-IV binds to TTX-S with an IC50value of 34 nM in adult rat dorsal root ganglion (DRG) neurons. Tetrodotoxin-resistant (TTX-R) voltage-gated sodium channels are not affected by Hainantoxin-IV. It probably interacts with the site 1 through a mechanism quite similar to that of TTX without affecting the activation and inactivation kinetics.

Product Specifications

Specifications

Blocker of voltage-gated sodium channels

Target

Na channels

Sequence

ECLGFGKGCNPSNDQCCKSSNLVCSRKHRWCKYEI

Peptide Number

12HTX001

Disulfide Bonds

Cys2-Cys17; Cys9-Cys24; ; Cys16-Cys31

N Terminal Sequence

H

C Terminal Sequence

NH2

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit NRG-2 (Neuregulin 2) ELISA Kit
MBS2505534-01 24 Tests

Rabbit NRG-2 (Neuregulin 2) ELISA Kit

Sign In for Pricing
View Details
Rabbit NRG-2 (Neuregulin 2) ELISA Kit
MBS2505534-02 48 Tests

Rabbit NRG-2 (Neuregulin 2) ELISA Kit

Sign In for Pricing
View Details
Rabbit NRG-2 (Neuregulin 2) ELISA Kit
MBS2505534-03 96 Tests

Rabbit NRG-2 (Neuregulin 2) ELISA Kit

Sign In for Pricing
View Details
Rabbit NRG-2 (Neuregulin 2) ELISA Kit
MBS2505534-04 5x 96 Tests

Rabbit NRG-2 (Neuregulin 2) ELISA Kit

Sign In for Pricing
View Details
Rabbit NRG-2 (Neuregulin 2) ELISA Kit
MBS2505534-05 10x 96 Tests

Rabbit NRG-2 (Neuregulin 2) ELISA Kit

Sign In for Pricing
View Details
Mouse Mb activation kit by CRISPRa
GA202589 1 Kit

Mouse Mb activation kit by CRISPRa

Sign In for Pricing
View Details