Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Echistatin α1 isoform

Echistatin was originally purified from the venom of the viper Echis carinatus. Echistatin is a cyclic RGD peptide that inhibits platelet aggregation by inhibiting the glycoprotein IIb/IIIa complex receptor. Echistatin is a potent disintegrin that antagonize αVβ3 integrin and has been described to inhibit cell proliferation, migration, invasion, and adhesion of αVβ3 expressing cells.

Product Specifications

CAS Number

154303-05-6

Specifications

Antagonization of αVβ3 integrin. Inhibition of cell proliferation, migration, invasion, and adhesion of αVβ3 expressing cells.

Target

Integrins

Sequence

ECESGPCCRNCKFLKEGTICKRARGDDMDDYCNGKTCDCPRNPHKGPAT

Peptide Number

ECH001

Disulfide Bonds

Cys2-Cys11; Cys7-Cys32; Cys8-Cys37; Cys20-Cys39

N Terminal Sequence

H

C Terminal Sequence

OH

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Yarrowia lipolytica Endopolyphosphatase (PPN1), partial
MBS1477047 Inquire

Recombinant Yarrowia lipolytica Endopolyphosphatase (PPN1), partial

Sign In for Pricing
View Details
Tuba1c (BC022182) Mouse Tagged ORF Clone Lentiviral Particle
MR207167L4V 200 µL

Tuba1c (BC022182) Mouse Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
Phospho-BRAF (Ser729) Antibody [H9E15]
C21678-50uL 50 μL

Phospho-BRAF (Ser729) Antibody [H9E15]

Sign In for Pricing
View Details
Frozen Tissue Sections, Lung
CS514300 5x 5 µm

Frozen Tissue Sections, Lung

Sign In for Pricing
View Details
Recombinant Chlamydia W4 Protein, Untagged, E.coli-100ug
QP11416-100ug 100ug

Recombinant Chlamydia W4 Protein, Untagged, E.coli-100ug

Sign In for Pricing
View Details
10 KDa Heat Shock Protein, Mitochondrial / HSP10 (HSPE1) Antibody (ATTO390)
abx445753 100 µg

10 KDa Heat Shock Protein, Mitochondrial / HSP10 (HSPE1) Antibody (ATTO390)

Sign In for Pricing
View Details