Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Echistatin α1 isoform

Echistatin was originally purified from the venom of the viper Echis carinatus. Echistatin is a cyclic RGD peptide that inhibits platelet aggregation by inhibiting the glycoprotein IIb/IIIa complex receptor. Echistatin is a potent disintegrin that antagonize αVβ3 integrin and has been described to inhibit cell proliferation, migration, invasion, and adhesion of αVβ3 expressing cells.

Product Specifications

CAS Number

154303-05-6

Specifications

Antagonization of αVβ3 integrin. Inhibition of cell proliferation, migration, invasion, and adhesion of αVβ3 expressing cells.

Target

Integrins

Sequence

ECESGPCCRNCKFLKEGTICKRARGDDMDDYCNGKTCDCPRNPHKGPAT

Peptide Number

ECH001

Disulfide Bonds

Cys2-Cys11; Cys7-Cys32; Cys8-Cys37; Cys20-Cys39

N Terminal Sequence

H

C Terminal Sequence

OH

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse 2'-5'-Oligoadenylate Synthase 1 (OAS1) ELISA Kit
abx154482-01 96 Tests

Mouse 2'-5'-Oligoadenylate Synthase 1 (OAS1) ELISA Kit

Sign In for Pricing
View Details
Mouse 2'-5'-Oligoadenylate Synthase 1 (OAS1) ELISA Kit
abx154482-02 5x 96 Tests

Mouse 2'-5'-Oligoadenylate Synthase 1 (OAS1) ELISA Kit

Sign In for Pricing
View Details
Mouse 2'-5'-Oligoadenylate Synthase 1 (OAS1) ELISA Kit
abx154482-03 10x 96 Tests

Mouse 2'-5'-Oligoadenylate Synthase 1 (OAS1) ELISA Kit

Sign In for Pricing
View Details
Wulfenioidin F
T80002-01 5 mg

Wulfenioidin F

Sign In for Pricing
View Details
Wulfenioidin F
T80002-02 50 mg

Wulfenioidin F

Sign In for Pricing
View Details
ZNF131 (NM_003432) Human Recombinant Protein
TP314634M 100 µg

ZNF131 (NM_003432) Human Recombinant Protein

Sign In for Pricing
View Details