Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Cy3-Crotamine

Cy3-crotamine is a fluorescent version of Crotamine which is a basic peptide present in the venom of the South American rattlesnake Crotalus durissus terrificus. Multiple biological functions have been attributed to Crotamine. It is a natural cell-penetrating peptide with selective biological action towards actively proliferating cell types such as tumor cells. Moreover, it has been reported that crotamine is a blocker of Kv1.3 (IC50 around 300 nM) as well as Kv1.1 and Kv1.2. It has analgesic properties and myonecrotic effects. In addition, crotamine belongs to the beta-defensin peptides and as such demonstrates antibacterial properties by interacting with lipid membranes.

Product Specifications

Specifications

Blocker of Kv1.3, Kv1.1 and Kv1.2 channels / Cell Penetrating Peptide

Target

Others

Sequence

YKQCHKKGGHCFPKEKICLPPSSDFGKMDCRWRWKCCKKGSG

Peptide Number

CRO002

Disulfide Bonds

Cys4-Cys36; Cys11-Cys30; Cys18-Cys37

N Terminal Sequence

Cy3

C Terminal Sequence

OH

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TLR1 Double Nickase Plasmid (h2)
sc-402458-NIC-2 20 µg

TLR1 Double Nickase Plasmid (h2)

Sign In for Pricing
View Details
UXS1 CRISPR Activation Plasmid (m)
sc-426802-ACT 20 µg

UXS1 CRISPR Activation Plasmid (m)

Sign In for Pricing
View Details
SSTR5 HDR Plasmid (m)
sc-423044-HDR 20 µg

SSTR5 HDR Plasmid (m)

Sign In for Pricing
View Details
Abtb1 sgRNA CRISPR Lentivector (Rat) (Target 2)
K7246203 1.0 µg DNA

Abtb1 sgRNA CRISPR Lentivector (Rat) (Target 2)

Sign In for Pricing
View Details
Neurl4 Rat siRNA Oligo Duplex (Locus ID 303248)
SR514177 1 Kit

Neurl4 Rat siRNA Oligo Duplex (Locus ID 303248)

Sign In for Pricing
View Details
GNA12 (Guanine Nucleotide-Binding Protein Subunit Alpha-12 Ensembl ENSP00000385935, Guanine Nucleotide Binding Protein (G Protein) Alpha 12)
481947 100 µL

GNA12 (Guanine Nucleotide-Binding Protein Subunit Alpha-12 Ensembl ENSP00000385935, Guanine Nucleotide Binding Protein (G Protein) Alpha 12)

Sign In for Pricing
View Details