Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Cy3-Crotamine

Cy3-crotamine is a fluorescent version of Crotamine which is a basic peptide present in the venom of the South American rattlesnake Crotalus durissus terrificus. Multiple biological functions have been attributed to Crotamine. It is a natural cell-penetrating peptide with selective biological action towards actively proliferating cell types such as tumor cells. Moreover, it has been reported that crotamine is a blocker of Kv1.3 (IC50 around 300 nM) as well as Kv1.1 and Kv1.2. It has analgesic properties and myonecrotic effects. In addition, crotamine belongs to the beta-defensin peptides and as such demonstrates antibacterial properties by interacting with lipid membranes.

Product Specifications

Specifications

Blocker of Kv1.3, Kv1.1 and Kv1.2 channels / Cell Penetrating Peptide

Target

Others

Sequence

YKQCHKKGGHCFPKEKICLPPSSDFGKMDCRWRWKCCKKGSG

Peptide Number

CRO002

Disulfide Bonds

Cys4-Cys36; Cys11-Cys30; Cys18-Cys37

N Terminal Sequence

Cy3

C Terminal Sequence

OH

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Pro-Neuropeptide Y (NPY) Antibody
abx002280-01 60 µL

Pro-Neuropeptide Y (NPY) Antibody

Sign In for Pricing
View Details
Pro-Neuropeptide Y (NPY) Antibody
abx002280-02 120 µL

Pro-Neuropeptide Y (NPY) Antibody

Sign In for Pricing
View Details
Pro-Neuropeptide Y (NPY) Antibody
abx002280-03 200 µL

Pro-Neuropeptide Y (NPY) Antibody

Sign In for Pricing
View Details
SLC25A37 sgRNA CRISPR Lentivector (Human) (Target 3)
K2180004 1.0 µg DNA

SLC25A37 sgRNA CRISPR Lentivector (Human) (Target 3)

Sign In for Pricing
View Details
PKD1/PKC mu Mouse Monoclonal Antibody
BF8168-01 100 µL

PKD1/PKC mu Mouse Monoclonal Antibody

Sign In for Pricing
View Details
PKD1/PKC mu Mouse Monoclonal Antibody
BF8168-02 200 µL

PKD1/PKC mu Mouse Monoclonal Antibody

Sign In for Pricing
View Details