Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Crotamine

Crotamine is a basic peptide present in the venom of the South American rattlesnake Crotalus durissus terrificus. Multiple biological functions have been attributed to Crotamine. It is a natural cell-penetrating peptide with selective biological action towards actively proliferating cell types. Moreover, it has been reported that crotamine is a blocker of Kv1.3 (IC50 around 300 nM) as well as Kv1.1 and Kv1.2. It has analgesic properties and myonecrotic effects. In addition, crotamine belongs to the beta-defensin peptides and as such demonstrates antibacterial properties by interacting with lipid membranes.

Product Specifications

Specifications

Blocker of Kv1.3, Kv1.1 and Kv1.2 channels / Cell Penetrating Peptide

Target

Others

Sequence

YKQCHKKGGHCFPKEKICLPPSSDFGKMDCRWRWKCCKKGSG

Peptide Number

CRO001

Disulfide Bonds

Cys4-Cys36; Cys11-Cys30; Cys18-Cys37

N Terminal Sequence

H

C Terminal Sequence

OH

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse GPX2 shRNA Plasmid
abx970642-01 150 µg

Mouse GPX2 shRNA Plasmid

Sign In for Pricing
View Details
Mouse GPX2 shRNA Plasmid
abx970642-02 300 µg

Mouse GPX2 shRNA Plasmid

Sign In for Pricing
View Details
SLC39A10 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)
44178111 3x 1.0 µg

SLC39A10 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)

Sign In for Pricing
View Details
RPP40 siRNA (Mouse)
CRN1573-01 15 nmol

RPP40 siRNA (Mouse)

Sign In for Pricing
View Details
RPP40 siRNA (Mouse)
CRN1573-02 30 nmol

RPP40 siRNA (Mouse)

Sign In for Pricing
View Details
Anti-PfLDH Antibody, Rabbit Polyclonal
MBS8110661-01 0.02 mL

Anti-PfLDH Antibody, Rabbit Polyclonal

Sign In for Pricing
View Details