Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Crotamine

Crotamine is a basic peptide present in the venom of the South American rattlesnake Crotalus durissus terrificus. Multiple biological functions have been attributed to Crotamine. It is a natural cell-penetrating peptide with selective biological action towards actively proliferating cell types. Moreover, it has been reported that crotamine is a blocker of Kv1.3 (IC50 around 300 nM) as well as Kv1.1 and Kv1.2. It has analgesic properties and myonecrotic effects. In addition, crotamine belongs to the beta-defensin peptides and as such demonstrates antibacterial properties by interacting with lipid membranes.

Product Specifications

Specifications

Blocker of Kv1.3, Kv1.1 and Kv1.2 channels / Cell Penetrating Peptide

Target

Others

Sequence

YKQCHKKGGHCFPKEKICLPPSSDFGKMDCRWRWKCCKKGSG

Peptide Number

CRO001

Disulfide Bonds

Cys4-Cys36; Cys11-Cys30; Cys18-Cys37

N Terminal Sequence

H

C Terminal Sequence

OH

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

EXOSC6 Double Nickase Plasmid (h)
sc-405680-NIC 20 µg

EXOSC6 Double Nickase Plasmid (h)

Sign In for Pricing
View Details
IL2 Receptor beta (IL2RB) Human Recombinant Protein
TP724810 10 µg

IL2 Receptor beta (IL2RB) Human Recombinant Protein

Sign In for Pricing
View Details
Recombinant Mouse Noelin (Olfm1)
MBS1037597-01 0.02 mg (E-Coli)

Recombinant Mouse Noelin (Olfm1)

Sign In for Pricing
View Details
Recombinant Mouse Noelin (Olfm1)
MBS1037597-02 0.02 mg (Yeast)

Recombinant Mouse Noelin (Olfm1)

Sign In for Pricing
View Details
Recombinant Mouse Noelin (Olfm1)
MBS1037597-03 0.1 mg (E-Coli)

Recombinant Mouse Noelin (Olfm1)

Sign In for Pricing
View Details
Recombinant Mouse Noelin (Olfm1)
MBS1037597-04 0.1 mg (Yeast)

Recombinant Mouse Noelin (Olfm1)

Sign In for Pricing
View Details