Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Charybdotoxin

Charybdotoxin (ChTx) is a 37 amino acid peptide isolated from the venom of the scorpion Leiurus quinquestriatus hebraeus that blocks voltage-gated and large conductance Ca2+ activated K+ channels KCa1.1 in nanomolar concentrations (IC50~ 3 nM) . This blockade causes hyperexcitability of the nervous system. The toxin reversibly blocks channel activity by interacting at the external pore of the channel protein with an apparent Kd of 2.1 nM. ChTX also blocks KCa3.1 (IC50 5 nM), Kv1.2 (IC50 14 nM), Kv1.3 (IC50 2.6 nM) and Kv1.6 (IC50 2 nM) channels.

Product Specifications

CAS Number

95751-30-7

Specifications

KCa2+ channel blocker

Target

K channels

Sequence

FTNVSCTTSKECWSVCQRLHNTSRGKCMNKKCRCYS

Peptide Number

11CHA001

Disulfide Bonds

Cys7-Cys28; Cys13-Cys33; ; Cys17-Cys35

N Terminal Sequence

PQ

C Terminal Sequence

OH

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Polyclonal HSD5 Antibody
NBP2-58856 100 µL

Rabbit Polyclonal HSD5 Antibody

Sign In for Pricing
View Details
TMEM16B Peptide
MBS153255-01 0.05 mg

TMEM16B Peptide

Sign In for Pricing
View Details
TMEM16B Peptide
MBS153255-02 5x 0.05 mg

TMEM16B Peptide

Sign In for Pricing
View Details
Syk (D-3) Alexa Fluor® 594
sc-166226 AF594 200 µg/mL

Syk (D-3) Alexa Fluor® 594

Sign In for Pricing
View Details
Alpha B Crystallin Rabbit Polyclonal Antibody (Biotin)
orb458681 100 µL

Alpha B Crystallin Rabbit Polyclonal Antibody (Biotin)

Sign In for Pricing
View Details
AR ligand 40
HY-173498 1 Each

AR ligand 40

Sign In for Pricing
View Details