Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

BeKm-1

BeKm-1 toxin is a peptide toxin that has been isolated from the venom of the Central Asian scorpion Buthus eupeus. BeKm-1 toxin has been reported to be a highly selective inhibitor of the human ether-a-go-go ERG1 channel (hERG1) . BeKm-1 inhibits hERG1 channels expressed in HEK-293 cells with an IC50 of 3.3 nM, but has no effect at 100 nM on human EAG, human SK1, rat SK2, human IK, human BK, KCNQ1/KCNE1, KCNQ2/KCNQ3, and KCNQ4 channels. It has also minimal effects on rat ELK1 channel. BeKm-1 inhibits the human ERG1 + KCNE1 combination transiently expressed in HEK-293 cells with an IC50 value in the range of 10 to 30 nM. BeKm-1 toxin preferentially blocks human ERG channel through the closed (resting) state, although some open channel blockade is also reported to occur.

Product Specifications

Specifications

Selective blocker of ERG1 channel

Target

K channels

Sequence

RPTDIKCSESYNCFPVCKSRFGKTNGRCVNGFCDCF

Peptide Number

13BEK001

Disulfide Bonds

Cys7-Cys28; Cys13-Cys33; Cys17-Cys35

N Terminal Sequence

H

C Terminal Sequence

OH

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral human CCDC62 shRNA (UAS) - Lentiviral human CCDC62 shRNA (UAS) plasmid
GTR15321034 1 Vial

Lentiviral human CCDC62 shRNA (UAS) - Lentiviral human CCDC62 shRNA (UAS) plasmid

Sign In for Pricing
View Details
Cy7-PEG-Biotin, 20K
FL080041-20K Inquire

Cy7-PEG-Biotin, 20K

Sign In for Pricing
View Details
Anti-Rat CNTF Rabbit Polyclonal Antibody
TA328576 100 µg

Anti-Rat CNTF Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
CD3 Gamma/CD3G Rabbit Polyclonal Antibody (Fluoro550)
orb3104819 100 µg

CD3 Gamma/CD3G Rabbit Polyclonal Antibody (Fluoro550)

Sign In for Pricing
View Details
EPHA7 antibody
70R-31904 100 ug

EPHA7 antibody

Sign In for Pricing
View Details
Glutamine (GLN) ELISA Kit
EKN52702 96 Tests

Glutamine (GLN) ELISA Kit

Sign In for Pricing
View Details